×

Download App Today & Register Now

Get Flat ₦100 on your RM Wallet*

Buy Household Cleaning Products online in Nigeria

Household Cleaning Products

icon_filter
Filters
Mopar
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
To keep your home clean or & nbsp;germ free without having to touch the dirty wiping cloth, you can opt for this utilitarian PVC Magic Mop at & nbsp; at an affordable price. This magic mop will help you to clean your home in a hassle free manner and without creating a mess. You can now clean the floors without stretching or bending as this mop comes with a long rod for convenience. This cleaning tool will help you keep your home spic and span.This Mop is made of good quality PVC and is high on quality and utility. The PVC makes this mop and bucket set durable and long-lasting. The mop and bucket is also compact in size and can be stored anywhere when not in use. The handle of the easy to clean mop is ergonomically designed and that ensures a firm grip.The PVC Magic Mop can help you clean with optimum efficiency. The mop can rotate 360 degrees that allows you to clean areas that are usually difficult to reach. As the mop head can conveniently squeeze out water on its own, you do not have to rinse it yourself.
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
₦ 21,780.00 ₦ 22,000.00 -1%
Plate
stylish unbreakable plates.
Portable Ideal & nbsp; Long lasting & nbsp; can be carried about & nbsp; unbreakable Eco friendly & nbsp; rugged & nbsp; & nbsp;
stylish unbreakable plates.
stylish unbreakable plates.
₦ 5,940.00 ₦ 6,000.00 -1%
Rubberex
Protection Bath Mat
Enhanced Safety: Equipped with high-traction suction cups that lock the mat firmly to the floor, helping to prevent slips and falls, especially in wet conditions. Water-Resistant Design: Crafted from high-quality PVC material that & rsquo;s mold-resistant, odor-free, and built to withstand daily use. Quick-Dry Technology: Features a breathable drainage system that promotes faster water evaporation, keeping your bathroom floor clean and dry. Gentle on Skin: Designed with a soft textured surface that feels soothing underfoot & ndash; perfect for kids, adults, and seniors. Universal Fit: Ideal for bathtubs, shower stalls, and tiled floors, making it the perfect solution for any home or spa environment.
Protection Bath Mat
Protection Bath Mat
₦ 6,435.00 ₦ 6,500.00 -1%
WOODEN
6pcs Scrubbing Hard Brush
Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing. Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.
6pcs Scrubbing Hard Brush
6pcs Scrubbing Hard Brush
₦ 9,900.00 ₦ 10,000.00 -1%
XFORCE
XFORCE Fast Rat Catcher Gum Mouse Glue Trap Rat Trap Board X 2 Pieces
There is nothing as shaming and disgusting & nbsp;as seeing rats & nbsp;run up and down in your home or office, that's why we create this rat glue board to trap all mice in your home quickly and effectively.One of its advantage over rat poison is that it is safe and can not cause any harm to adult and children and there cannot be cases of smell as a result of rat dieing in an unknown place. & nbsp;Our firm specializes in providing our prestigious clients with quality Rat Catcher Gum. Rat gum is processed and manufactured using exceptional quality basic material and advanced technology, in compliance with international norms. Our rat gum trap is tested on different parameters under the supervision of skilled professionals. & nbsp;There is nothing as shaming and disgusting & nbsp;as seeing rats & nbsp;run up and down in your home or office, that's why we create this rat glue board to trap all mice in your home quickly and & nbsp;There is nothing as shaming and disgusting & nbsp;as seeing rats & nbsp;run up and down in your home or office, that's why we create this rat glue board to trap all mice in your home quickly and effectively.
Cleaner
Anti-bacterial Toilet Cleaner - 10 Pcs
TOILET CLEANER.
Anti-bacterial Toilet Cleaner - 10 Pcs
Anti-bacterial Toilet Cleaner - 10 Pcs
₦ 2,673.00 ₦ 2,700.00 -1%
Rubbermaid
Welcome Entry Smart Rubber Door Footmat
This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.
Welcome Entry Smart Rubber Door Footmat
Welcome Entry Smart Rubber Door Footmat
₦ 12,870.00 ₦ 13,000.00 -1%
Foot Cover
Welcome Entry Smart Rubber Door Footmat
This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.This Colourful Door Foot Mat is your first line of defense against sticky mud, dirt, grease etc. They are made to withstand most extreme of environments. It is economical, easy to clean and resistant to molds as well as slip.
Welcome Entry Smart Rubber Door Footmat
Welcome Entry Smart Rubber Door Footmat
₦ 7,425.00 ₦ 7,500.00 -1%
Security
Digital Security Padlock
Padlocks are portable locks with a shackle that may be passed through an opening (such as a chain link) to prevent use, theft, vandalism or harm.This lock is a professional outdoor use of Stainless Steel, Waterproof, Rust-Proof, Anti-Theft, Corrosion Resistance.
Digital Security Padlock
Digital Security Padlock
₦ 19,800.00 ₦ 20,000.00 -1%
Foot Mate
ANTI SLIP FOOT-MAT FOR BATHROOM / DOOR 1PCs
Comfy feet shaped floor mat is carpet top and rubber backing & nbsp;for & nbsp;indoor use. It reduce slips and falls it will ensure your floor remain safe and dry. & nbsp;can be used in the living room and bed room Washing Instructions Rinse throughly but not wring Dry out of sunlight Do not iron Do not put it in bleach water & nbsp;Product InformationThe back design is non slip, moistureproof, mildew proof, durable, cool, wearable, easy to clean and cost-effective.Comfortable feet, soft feet, relieve foot pressure.Easy to use and clean.Easy to use and clean.
ANTI SLIP FOOT-MAT FOR BATHROOM / DOOR 1PCs
ANTI SLIP FOOT-MAT FOR BATHROOM / DOOR 1PCs
₦ 3,960.00 ₦ 4,000.00 -1%
Plastic
High Quality Wooden Broom For Cleaning and Sweeping - Multi-color
Plastic brooms are incredibly versatile cleaning tools. They can be & nbsp;used & nbsp;both indoors and outdoors, making them a go-to choice for many cleaning tasks. Whether you're sweeping the kitchen floor, the driveway, or the patio, a plastic broom can handle the job with ease The plastic broom can be used for home, offices, bathroom and toilet. It is more durable and easy to use than the old wooden Brooms & nbsp;
Plastic
Plastic Handle Shopping Basket Pieces
Strong Plastic Handle. & nbsp;Strong Plastic. & nbsp;Easy to move around. & nbsp; & nbsp;
Plastic Handle Shopping Basket  Pieces
Plastic Handle Shopping Basket Pieces
₦ 11,880.00 ₦ 12,000.00 -1%
Mopower
mop
Make Clean Easier. The cleaning tray adopts the latest type of triangular design, 360 & deg; rotating mop head allows you to leave no dust in the dead corner, easily solve your stubborn dust in the corner of the wall, ceiling and window. Say no to danger. Extra-long 1.3m pole to easily reach dust locations and help you eliminate dust in a simpler way. Premium Material. The mop is equipped with thickened and encrypted microfiber mop cloth, which can quickly absorb water within 5 seconds and has superb adsorption ability, firmly locking in the dust.
mop
mop
₦ 3,960.00 ₦ 4,000.00 -1%
Mopower
Quality Mopping Stick
Cleaning is one of our most importanr daily activity the must be done which inmproves our hygine highly. the use of mops comes in here so that cleaning could be done more easily.The pole (stick) is very strong to prevent that annoying breakage we witness when mopping with energy. The cotton made clothe is also thick and very absorbent. You can be sure the cotton string do not pull out randomly during use, as they were firmly fitted to last long and get the job done. If you are tired of buying mopping stick that last only days before getting damaged, this is the best choice for you.
Quality Mopping Stick
Quality Mopping Stick
₦ 3,960.00 ₦ 4,000.00 -1%
Plastic
Dust Pan
For home, as souvenir & nbsp;at parties, birthday, wedding etc. What more! & nbsp; Keep your environment in tip-top shape with this dust pan! Made of durable plastic, this dust pan is built to withstand repeated use in virtually any setting. The unique design is tough and sturdy, yet still flexible, offering greater versatility of use. This dust pan will not warp or bend over time. In addition, this dust pan has a thin front edge to allow for maximum pick-up. This convenient feature prevents that pesky line of dirt from being left behind after sweeping up. There's also a built-in hanging slot which ensures efficient, space-saving storage when the dust pan is not in use. Offering high-quality function at an economical price, this Continental dust pan is a must-have addition to any venue. & nbsp;
Dust Pan
Dust Pan
₦ 990.00 ₦ 1,000.00 -1%
AKAI
AKAI COFFEE MAKER
Model: CM004A_1051 1.5L Coffee Pot 800W ON/OFF BUTTON & nbsp; REMOVABLE & amp; WASHABLE FILTER & nbsp; KEEP -WARM FUNCTION & nbsp; ANTI-DRIP FUNCTION.
AKAI COFFEE MAKER
AKAI COFFEE MAKER
₦ 38,000.00 ₦ 40,000.00 -5%
silver crest
Silver Crest Bland SC-1589
suitable for grinding beans, maize, etc Strong elecric motor HIGH strength speed & nbsp; HEAVY DUTY ball bearing 20 sec quick grinding Strong BLADES 450000W Double Cup & nbsp;
Silver Crest Bland SC-1589
Silver Crest Bland SC-1589
₦ 41,580.00 ₦ 42,000.00 -1%
Aluminium
5 set aluminium pot
Queen Time iron cast Stone Cookware Set 5 PCsFeatures :A luxurious cooking set consisting of 5 pieces of cooking pots of different sizes, which makes them suitable for many uses. Each of them is attached to a glass lid, and it also contains a soft-touch handle that is comfortable during use. Made of natural minerals added to the coating that enhance the marbling function, allowing healthy cooking without food sticking.High-quality marble coating on the interior and exterior of the cookware makes it easy to clean with repeated use.Glass lids allow for even distribution of steam and heat within the cookware for the best taste.
5 set aluminium pot
5 set aluminium pot
₦ 71,280.00 ₦ 72,000.00 -1%
Plastic
Medium basket 3 pieces multi color
DURABLE AND STRONG: MIND READER storage is made with good -quality plastic
Medium basket 3 pieces multi color
Medium basket 3 pieces multi color
₦ 14,850.00 ₦ 15,000.00 -1%
Plastic
Laundry basket
Large size laundry basket is ideal for use by the whole family. It has ventilated slots to prevent odor build-up. It also has a sturdy base to withstand heavy use, making it easy to keep your home clean DEEP STORAGE: Pile on as many clothes as you need! Place your clean or dirty clothing in this laundry sorter that easily stores much clothing. DURABLE AND STRONG: MIND READER storage is made with good -quality plastic AIRFLOW DESIGN: Designed with ventilated slot that lets airflow in and out of your plastic laundry basket, promoting ventilation and preventing odor build-up that happens with traditional laundry bags. ORGANIZER: This laundry basket with lid can be used for organization and storage too! Conveniently keep all your clothes or items in one space and close the lid
Laundry basket
Laundry basket
₦ 7,425.00 ₦ 7,500.00 -1%
Plastic
Laundry basket with cover
This large size laundry basket is ideal for use by the whole family. It has ventilated slots to prevent odour build-up. It also has a sturdy base to withstand heavy use, making it easy to keep your home clean
Laundry basket with cover
Laundry basket with cover
₦ 10,395.00 ₦ 10,500.00 -1%
Plastic
Water storage tank
This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.This Plastic Drum open and closed Type 200L, Cleaned Item Outside lever type With size body diameter approximately 580 & phi; & times; height approximately 880 mm.comes in beautiful condition. use such as storage, display, water storage tank, waste storage, moving container, etc. will be a set of body, lid and band depending on the idea.
Water storage tank
Water storage tank
₦ 23,760.00 ₦ 24,000.00 -1%
Generic
Mortar and Pestle
Description Weight 0.20 kg Colour Multicolour HIGH QUALITY PP PLASTIC MATERIAL - The mortar and pestle set is made of high quality thick PP plastic, making mortar and pestle easy to clean and less prone to damage than granite. This ensures durability, environmental protection and non-toxicity and ensures long working hours. ERGONOMIC PISTON DESIGN - Mortar and pestle sets features an ergonomic design that is comfortable to hold and the smooth surface will not hurt your hand after long-term use. EASY TO CLEAN - Simply place the mortar and pestle in warm water with a little dishwashing liquid until all stains are removed, then dry thoroughly with a clean tea towel or allow to air dry. Please wash before first use.   Manual operation helps you to easily grind garlic and ginger into minced or powdered pieces.   Dimension: 11x 10cm
Mortar and Pestle
Mortar and Pestle
₦ 8,415.00 ₦ 8,500.00 -1%
loader
Generic
4PCS Dummy Wasp Nest - Artificial Wasp Nest
Artificial wasp nests are considered hostile by territorial hornets.WATERPROOF FABRIC: The moisture-proof fabric of the 's nest dummy makes it more sturdy in use. Place the nest before wasp time. The perfect height is 2 to 2.5 meters.MODERN WEAR: Carefully pull the dummy apart, slide the clamping bracket through the opening, carefully open the bracket, and hang it up. Important: Removing Existing Wasp NestsWe rely on insect instinct to repel wasps. Wasps do not settle directly to a species, but continue to move.Different batches, slightly differentColour:yellowMaterial:waterproof clothSize:about 22 x 28cmPackage Contents:4 x Wasp LanternOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.Key FeaturesWasp Lanternbalconyinsect spraywasp nest dummybeehivewaspsprayWhat's In the Box4 x Wasp Lantern
4PCS Dummy Wasp Nest - Artificial Wasp Nest
4PCS Dummy Wasp Nest - Artificial Wasp Nest
₦ 42,596.85 ₦ 44,838.79 -5%
loader
Generic
Hair Catcher, Hair Trap for Shower Drain, Hair Collector(Blue)
Bathroom wall hair catcher. Effectively collects loose hair and prevents hair from clogging drains.Easy to capture and release hair. Swipe left to collect finger hair, swipe right to remove catcher hair.Detachable design for easy cleaning. Even if you have the hair collector mounted on the wall, you can still remove it for cleaning.Soft, flexible directional bristles. Made of soft high-quality silicone, non-plastic, not hurting hands, non-slip, elastic and wear-resistant.There are two ways to install this hair extender, after cleaning the wall, stick one side of the adhesive sheet to the back panel of the hair extender with a little pressure, then stick the other side where you want to stick it, wait 24 hours to make it stick more firmly before use. Or nail it anywhere you want, tile, stone, wood, plastic, etc.Colour:blueMaterial:Plastic + SiliconeSize:about 77 x 50 x 33mmPackage Contents:1 x Shower Hair CatcherOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesShower Hair CatcherHair CatcherHair Catcher Shower WallHair CollectorReusable Hair CatcherWhat's In the Box1 x Shower Hair Catcher
Hair Catcher, Hair Trap for Shower Drain, Hair Collector(Blue)
Hair Catcher, Hair Trap for Shower Drain, Hair Collector(Blue)
₦ 19,045.55 ₦ 20,047.95 -5%
Generic
Magic X-type Microfiber Floor Mop 360 Degree Flat Wood Ceramic Tiles Cle
Specifications: Material: Microfiber+ABS+Stainless steel Handle Size: 140cm/55" Mop Pad Size: 37x13cm/14.57"x5.2" [Conversion: 1cm=0.3937 inch, 1inch=2.54 cm] Features: ◆Made from strong, but light plastic. Extra long, easy to extend handle for cleaning hard-to places in the kitchen, under the couch, up on windows. Lightweight design for dusting and mopping under the couch and on walls. ◆Plastic mop handle and large strong head. Rotating 360 n head, industrial grade mop swivels. ◆Simulated wringing. One hand holds the handle of the floor mop, the hand easily push down the floor mop of Lower rod to wring out. Sliding repeatedly, the floor mop head can easily be screwed dry. ◆Perfect for cleaning all types of floors, including laminate, hardwood, tile, vinyl, , and concrete. Package Included: 1 x Floor Mop Note: -Due to different producing batches, product details might be a little different. If you mind the difference, please buy it carefully. -Please allow 1-3CM differs due to manual measurement. -Due to the different display and different light, the picture may not reflect the actual of the item. Thanks for your understanding. If you have any questions,please link us. Wish you have a happy shopping time! Key FeaturesEasy to useHigh quality and InexpensiveExquisite WorkmanshipDurable in useWell MadeEnjoy Great Popularity Among the PeopleSave your MoneyBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Floor Mop
loader
Generic
275ml Stainless Auto Handsfree Sensor Touchless Soap Dispenser Kitchen Bathroom Red
275ml Stainless Auto Handsfree Sensor Touchless Soap Dispenser Kitchen Bathroom a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Automatic Soap Dispenser 1 x Wall Hanging 1 x USB Charging Cable
loader
Generic
Creative Household Cartoon Professional Cleaning Cup Brush
Feature: and high quality Cute,Eco-Friendly,convenient Cartoon and vertical design,makes your kitchen more beautiful Description: Material: ABS+sponge Size: length 20cm(7.87in) Sponge diameter: 4.5cm(1.77in) Weight: 45g : (random when shipped) Package: 1 x Cup Brush a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Cup Brush
Creative Household Cartoon Professional Cleaning Cup Brush
Creative Household Cartoon Professional Cleaning Cup Brush
₦ 39,816.70 ₦ 41,912.32 -5%
Home Etcetera
Neutral Oven Glove
Description This Neutral Oven Glove from Home Etc is heat resistant which makes it perfect for all cooking uses. Please not allow the glove to touch naked flames or heat element.Key FeaturesHeat resistant18 x 32 cmNot to touch naked flames or heat elementPrevent burns to the arm from the ovenKitchen essentialWhat's In the Box1 x Neutral Oven Glove, Home Etc
Neutral Oven Glove
Neutral Oven Glove
₦ 15,051.11 ₦ 15,843.27 -5%
loader
Generic
Luggage Protective Cover For 30-32 Inch XL
Luggage Protective Cover1. Material: stretch fabric2. Function: breathable, wear-resistant3. Applicable gender: neutral / both men and women4. Hook and loop fastener design at the bottom, easy to install and disassemble5. Double-layer thickened fabric, high elasticity and more wear-resistant6. Digital printing, bright colors, not easy to fadeKey FeaturesLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverWhat's In the Box1 x package
Luggage Protective Cover For 30-32 Inch XL
Luggage Protective Cover For 30-32 Inch XL
₦ 48,141.16 ₦ 50,674.90 -5%
Ariel
Stain Remover Powder X6
Ariel formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try Ariel multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Ariel formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try Ariel multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Key FeaturesFirst-time stain removal, even in a cold wash 30°cIxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester
Stain Remover Powder X6
Stain Remover Powder X6
₦ 79,633.42 ₦ 83,824.65 -5%
loader
Generic
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
Description:The cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.This vegetable cleaning brush adopts hard silicone bristles, which can reach every corner and clean thoroughly.It is constructed of silicone material.The length of this vegetable cleaning brush is 10cm and width is 10cm.This vegetable cleaning brush is suitable for potatoes, sweet potatoes, carrots, corn and more.Item Name: Cleaning BrushMaterial: SiliconeColor: Yellow, Green, White, Purple, BlueFeatures: Multifunctional, Effective, BendableSize Details:10cm x 10cm/3.94" x 3.94" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Cleaning BrushKey FeaturesThe cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.Designed with finger clip, this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.The cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off because it is designed with finger clip.The cleaning brush is designed with finger clip, so it fits perfectly and comfortably in the palm of your hand and it will not slip off.The finger clip design of this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
₦ 6,087.55 ₦ 6,407.95 -5%
Generic
3 Piece Set Silicone Toilet Brush And Holder
The toilet brush head is water-repellent, eliminating the hassle of dripping. Selected materials ensure quality and longevity. the premium silicone toilet brush head has excellent durability. Cleaning time savings: Ergonomic handles make cleaning easier and reduce cleaning time. Comfortable, non-slip handle design, pack with stable and breathable mounting base, it is well ventilated. The simple and beautiful design is tailored to your bathroom. Lighter packaging makes life more environmentally friendly,more convenient to use, saving space, energy saving and environmental protection.Material: ABS+ TPRSize:40.6×14.3×5.6cmPackage Included:3 x Toilet Brush1 x Toilet Brush Holder.The toilet brush head is water-repellent, eliminating the hassle of dripping. Selected materials ensure quality and longevity. the premium silicone toilet brush head has excellent durability. Cleaning time savings: Ergonomic handles make cleaning easier and reduce cleaning time. Comfortable, non-slip handle design, pack with stable and breathable mounting base, it is well ventilated. The simple and beautiful design is tailored to your bathroom. Lighter packaging makes life more environmentally friendly,more convenient to use, saving space, energy saving and environmental protection.Material: ABS+ TPRSize:40.6×14.3×5.6cmPackage Included:3 x Toilet Brush1 x Toilet Brush HolderKey FeaturesMaterial : ABS + TPRAffordable Durable Easy to useLong lasting
3 Piece Set Silicone Toilet Brush And Holder
3 Piece Set Silicone Toilet Brush And Holder
₦ 26,555.13 ₦ 27,952.77 -5%
loader
Generic
Electric Clothes Lint Remover Hairball Trimmer Sweaters Carpet Fluff
Similar Items Description Electric clothes lint Remover Hairball Trimmer Sweaters Carpet Fluff Specifications: Item type: Hair Ball Trimmer :White Model: MQXJIQ01KL Size:145x62x65mm/5.66x2.42x2.54inch Input : 5V--1A Rated voltage: 3.7V Rated :2W (1cm=10mm=0.39inch) Measurement Details in the attached picture. Package included: 1x Hair Ball Trimmer 1x USB Cable 1x clean brush 1x English manual Features: -100% and high quality. -0.35mm micro-arc net to avoid pressing the net deformation to cause lifting clothes -5 leaf whirlwind floating head Increases shear efficiency and efficiently removes hair balls. -Negative centrifugal fan New design, stable and reliable suction. -Anti-backflow air duct design Avoid hair ball dander back to stain clothes. -Double safety protection device Disassemble the head cover or the ball cage automatically off. Notice -Please allow slight deviation of measurement due to manual measurement. -Due to different monitors and different light, the picture may not reflect the actual of the item. -Please consider the actual sizes in the listing as the pictures are generally enlarged to show detail. Ifyouhaveanyquestions,pleasecontactus. Wishyouhaveahappyshopping time. Detail Image a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1x Hair Ball Trimmer 1x USB Cable 1x clean brush 1x English manual
loader
Generic
3IN1 13L Smart Touch-free Motion/Knock/Touch Sensor Dustbin Rubbish Waste Pink USB Rechargeable
Features:[3 OPEN MODES: Infrared touchless sensor, Knock touch sensor and Manual mode. Using the most advanced sensor, can be sensed within 30cm, Hands or objects leave for 7 seconds, automatically close the cover, do not leave without closing.[TOUCHLESS SMART TRASH CAN: The motion sensor of the smart trash can automatically opens the lid. A precise motor and planetary gear system produces smooth, steady , you won't hear a thing.[KNOCK TOUCH SENSOR: The trash can with Intelligent knock touch, vibration sensor to open the cover, with the foot gently knock can open the cover, is very convenient and practical.[USB RECHARGEABLE: Our advanced smart trash can use usb charging, more energy-saving than -powered trash can, more convenient, ultra-low energy consumption.[EASY TO USE: You can use the hand sensor switch; You can touch it with your foot; Or you can press the button to turn on garbage can.[APPLICATION: Can be placed in the living room, kitchen, bedroom, bathroom, dormitory, gym and more. Induction trash can, beautiful, practical and easy to clean, create a simple lifestyle.Specification:Capacity: 13LMaterial: ABS,: White, Blue2 Optional: Powered, USB RechargeableNOTE:1. Please allow slight dimension difference due to manual measurement.2. Due to the light and screen difference, the item's may be slightly different from the pictures. Thanks for your understanding.Package Included:1 x 3-in-1 Smart Trash Can1 x Charging Cable( With USB Rechargeable Type) a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x 3-in-1 Smart Trash Can 1 x Charging Cable( With USB Rechargeable Type)
loader
Generic
Household Foldable Mop Bucket Home Kitchen Floor Cleaning Tools Portable Wash Basin
Similar Items Description Household Foldable Mop Bucket Home Kitchen Floor Cleaning Tools Portable Wash Basin Specifications: Model: E11517 Material: +TPR : Gray White Size: unfold: 43*28.4*18.3cm (16.9"x11.1"x7.2") fold: 47.6*28.4*7.7cm (18.7"x11.1"x3") Features: - With handle, very convenient to use. - Suitable for many types mop, tit can be folded when not in use, which can effectively saving space. - Suitable Place: For all camping, outdoor, , hiking, washing car, kitchen, family storage, bathroom, laundry room, garden and yard. Package included: 1 X foldable bucket (the mop in the picture NOT included) Note: Please allow slight 1-3cm difference due to manual measurement and a little for different display setting. The pictures are for reference, please make the object as the standard. Thank you for your understanding! Detail Image a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the BoxPackage included: 1 X foldable bucket (the mop in the picture NOT included)
loader
Generic
Elastic Wear-resistant Luggage Protective Cover M
Elastic Wear-resistant Luggage Protective Cover1. Material: polyester and spandex2. Function: Breathable and wear-resistant3. Suitable for gender: gender-neutral / male and female4. Side invisible zipper mouth, regardless of left and right handle5. Double layer thickened fabric, high elastic and more wear-resistant6. It is convenient to insert points and not easy to break7. Resin zipper, tight bite, smooth pull8. Four-wire seam, strong and not open9. Digital printing, bright colors, not easy to fade10. Size: S for 18-21 inches, M for 22-24 inches, L for 25-28 inches, XL for 29-32 inches11. Weight: S 240 g, M 310 g, L 370 g, XL 440 gKey FeaturesElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverWhat's In the Box1 x package
Elastic Wear-resistant Luggage Protective Cover M
Elastic Wear-resistant Luggage Protective Cover M
₦ 44,785.80 ₦ 47,142.95 -5%
loader
Generic
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
Detailed Information About The Product:as description and high qualityMade of high quality materials for durabilityStrong absorption, gentle cleaningReusable, washable, machine washablesize:13x13cm Material:fibercolour:GrayPackage Contents:2 x cleaning clothOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.20232. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityas description and high qualityMade of high quality materials for durabilityStrong absorption, gentle cleaningReusable, washable, machine washableThe details are as described aboveWhat's In the Box2 x cleaning cloth
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
₦ 12,862.15 ₦ 13,539.10 -5%
loader
Generic
Brush USB Rechargeable Electric Shoe Shine
Brush USB Rechargeable Electric Shoe ShineModel Number:Electric Shoes Polisher1. Product name: Electric leather care device2. Color: Charging black, charging gold3. Product weight: 752g4. Product size: 78.9X32X100mm5. Power mode: USB charging6. Rated power: 100W7. Rated frequency: 50Hz8. Uses: Used for daily leather care and shoes polishing9. Packing list: Host, dusting brush, grindstone, USB cable, oiling brush X2, polishing brush, brightening brush, shoe polish, instruction manualKey FeaturesProduct name: Electric leather care deviceColor: Charging black, charging goldProduct weight: 752gProduct size: 78.9X32X100mmPower mode: USB chargingWhat's In the Box1 x package
Brush USB Rechargeable Electric Shoe Shine
Brush USB Rechargeable Electric Shoe Shine
₦ 140,109.44 ₦ 147,483.62 -5%
loader
Generic
Microfiber Steam Mop Cover For Sienna
Microfiber Steam Mop Cover For SiennaFeature:Eco-FriendlyProduction:Scouring Pad1. Product Name: Steam mop replacement cloth2. Product Category: Mop Accessories3. Material: Fiber4. Applicable object: steam mop6. Size: 27.5x22.5cm7. Weight: 47g / piece8. Features: high water absorption, strong decontamination, no hair removal, long life, easy to clean, no lint, etc.Key FeaturesProduction:Scouring PadProduct Name: Steam mop replacement clothProduct Category: Mop AccessoriesMaterial: FiberApplicable object: steam mopWhat's In the Box1 x package
Microfiber Steam Mop Cover For Sienna
Microfiber Steam Mop Cover For Sienna
₦ 26,027.86 ₦ 27,397.75 -5%
loader
Generic
Plastic Leaf Scraper Kitchen Cleaning Tool Pot Bowl Pan Scraper
Description: Thisisascraperforkitchenuse. Itcanbeusedtoshavetheresidualoilfromthefryingpan,shavethestickyricefromthethericecooker,etc. Thelovelyleafshapemadeitdifferentfromtraditionalscrapers. Thepracticalandeasytousescraperwouldbegoodhelperforhousewives. Feature: Type:Scraper Shape: Green leaf Material:PPplastic Size:13.5*7.5cm Package:3xLeafscrapers Note: Productsandimagesmayexistchromaticaberration,pleaseunderstanding! Comparethedetailsizeswithyours,pleaseallow1-2cmdiffersduetomanualmeasurement! a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box3 x Leaf scrapers
loader
Generic
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
Multipurpose Tanning Mitt Set: This tanning glove set is perfect for different parts of your body, including 1 self-tanning glove, 1 mini tanning glove, a self-tanning back applicator and 1 body exfoliating glove .Ease of use: All four parts have different functions. The thumb of the grooming tanning glove allows for easy control. Self-tanning mitt back application makes it easier to reach the back. Mini tanning mitts easier to reach hard-to- areas.Skin-Friendly Soft Tanning Gloves: These self-tanning gloves are carefully from high-quality material, with perfect stitching structure, bringing you a super . The thumb of the self-tanning glove applicator fits perfectly in the palm of your hand without slipping off, it is easy to apply the evenly on your skin.MULTI-: The self-tanning glove applicator can be used with all tanning lotions, creams, mousses, sunscreens and sprays. Self-tanning gloves protect your hands from the without having to apply lotion on your hands.EASY TO CLEAN: After using the self-tanning mitt, dry it in water with your clothes, it can be washed with mild soap and warm water and sent to dry.Item Type: Tanning Applicatorcolor: as shownMaterial: Super Soft Cloth + Sponge + Waterproof MembraneSmall Gloves: . 9 X 8 Cm / 3.54 X 3.15 Inches Gloves: . 21.5 X 16.5 Cm / 8.3 X 5.1 InchesBack Applicator: . 82x 11cm / 32.3 X 4.3inFunction: When Tanning, It Can Help Spread Oil, Lotion, Mousse Evenly, Without WastingFeatures: ReusableCleaning: Rinse With Water And DryPackage Contents:1 x Thumb Glove1 x Mini Gloves1 x Exfoliating Gloves1 x Double Side Pull Back StripOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
₦ 24,366.17 ₦ 25,648.60 -5%
loader
Generic
Fitness Equipment Dust Cover
Fitness Equipment Dust Cover1. Material: Oxford cloth 2. Suitable for treadmills, joggers and other fitness equipment. 3. Easy to store and does not take up space. 4. Dustproof and sunscreen, durable. 5. Dimensions: 95x75x160cm, 80x60x150cmKey FeaturesFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverWhat's In the Box1 x package
Fitness Equipment Dust Cover
Fitness Equipment Dust Cover
₦ 80,879.69 ₦ 85,136.52 -5%
loader
Generic
Chair Waterproof Cover 89x89x120/89cm
Chair Waterproof Cover1. The main component content of the fabric: waterproof 210D Oxford cloth2. Color: black outside and silver inside3. Weight: 300 grams4. Size: 89x89x120/89cm5. 210D Oxford cloth, tear-resistant, easy to cleanKey FeaturesChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverWhat's In the Box1 x package
Chair Waterproof Cover 89x89x120/89cm
Chair Waterproof Cover 89x89x120/89cm
₦ 66,899.10 ₦ 70,420.10 -5%
loader
Generic
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
Features:[High-quality Material]: Made of superb TPR material, which is flexible, reliable and not easy to deform.[132 Holes & 196 Blocking Posts]: Composed fo 132 holes and 196 blocking posts of different length, it can effectively intercept hair residues, leach impurities, and protect sewers from clogging.[Multipurpose Drain Cover]: Applicable for most o-utlet of sinks, showers or tubs drain. [Creative Design]: Sucker at the bottom, anti-slip and fixed, and easily pick up. Cleaning your hair and not dirty hands.[Easy Installation & Cleaning]: Just put the hair stopper for shower drain into the corresponding sink. It can be washed by water, but it is better to add some detergent when there is oil. Specifications:Material: TRPColor: Blue, Green, Black, Red(optional)Item Diameter: 150mm/5.9inPackage Size: 150*150*10mm/5.9*5.9*0.4in(L*W*H)Package Weight: 44g/1.6ozPacking List:1*Sink Leaching CoverKey FeaturesSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverWhat's In the Box1xSink Leaching Cover,
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
₦ 6,646.77 ₦ 6,996.60 -5%
loader
Generic
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
Thick Elastic Luggage Dust Cover1. Made of high-quality polyester material, comfortable and wear-resistant2. Good elasticity, easy installation3. Precise hole , does not affect the normal use of the suitcase4. Various sizes and styles, you can choose according to your needs5. Material: Polyester6. Function: breathable, elastic, durable, boardableLining texture: polyester7. Size: S (for 20-23 inches), M (for 24-26 inches), L (for 27-29 inches), XL (for 30-32 inches), XXL (for 32-35 inches)8. Note: Only the dust jacket will be shipped, nothing else!Key FeaturesThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverWhat's In the Box1 x package
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
₦ 41,238.74 ₦ 43,409.20 -5%
loader
Generic
Low Toe Shoe Covers Men And Women Non-Slip Thick Bottom Flip Buckle Waterproof Rain Boots, Size: 40/41(White)
1. Applicable age: Adult2. Applicable gender: Both men and women3. Tube height: Low tube4. Thickness: Thicken5. Heel height: Flat heel6. Pattern: Solid color7. Upper material: PVCKey FeaturesLow ToeShoe CoversMen AndWomen Non-SlipThick BottomFlip BuckleWhat's In the BoxLow Toe Shoe Covers Men And Women Non-Slip Thick Bottom Flip Buckle Waterproof Rain Boots, Size: 40/41(White)
Generic
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
Dry your freshly cleaned clothes naturally outside in the sun or in your laundry room on a rainy day using this elegant airer.Made from steel with a clean powder coated finish, the airer is strong and secure, so you can simply unfold it ready for use.As well as three tiers of space, it has four side wings so you can dry clothes on hangers and move them to the wardrobe afterwards.The racks are made from tough steel with a powder coated finish which will prevent your clothes from slipping off as they dry.The airer measures 63 x 45w x 138h cm when opened and has a huge amount of drying space, so you can air a large load of laundryExtended to a height of 138cmFolds Flat for easy storageAuto lock Indoor and outdoor drying RackLarge deluxe size and compact design allows the drying of long items Folding compact design which makes it easily to stored when folded and easy to use locking mechanismLight weight and extra strong with coat hanger holders14m drying spaceSize when open 60w x 45(d)x138(h)cmFolded size : 63w X 8 (d) X 74hKey FeaturesExtended to a height of 138cmFolds Flat for easy storageAuto lock Indoor and outdoor drying RackLarge deluxe size and compact design allows the drying of long items Folding compact design which makes it easily to stored when folded and easy to use locking mechanismLight weight and extra strong with coat hanger holders14m drying spaceSize when open 60w x 45(d)x138(h)cmFolded size : 63w X 8 (d) X 74h
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
₦ 70,781.72 ₦ 74,507.07 -5%
Tchibo
Dish Washing Brush, Blue
Easy to wash: The dirt does not stick to the surface thanks to the rubber bristles of the dishwasher, the residues are easily cleaned. It also makes it possible to clean delicate surfaces while hand rinsing. Key Highlights: Rubber brush bristles Dirt does not stick and residue is easily cleaned Makes it possible to clean delicate surfaces while hand rinsing. Value for money Key FeaturesRubber brush bristles Dirt does not stick and residue is easily cleanedMakes it possible to clean delicate surfaces while hand rinsing.Value for moneyWhat's In the Box1 X Dish Washing Brush, Blue
Dish Washing Brush, Blue
Dish Washing Brush, Blue
₦ 15,929.89 ₦ 16,768.30 -5%
Lysol
All Purpose Cleaner Spray
This Lysol All-Purpose Cleaner Trigger makes a wonderful addition to anyone's collection of cleaning supplies. This plant based citric acid formula is viricidal, fungistatic and bactericidal. It contains no abrasive or bleach and has the ability to remove soap scum, lime scale and hard water stain on restroom fixtures and counters. Lysol All-Purpose Cleaner eliminates viruses, bacteria, soap scum, and tough grease. From kitchens to bathrooms to common household areas, Lysol All Purpose Cleaner helps achieve fresh, healthy surfaces. Cutting through tough grease and soap scum, it kills 99.9% of germs to help provide peace of mind for busy families. It is tested and proven to kill Sars-CoV-2 virus( Kills Sars-CoV-2 virus on hard, non porous surfaces in two minutes. Lysol All-Purpose Cleaner provides long lasting freshness and can be used on hard, non-porous surfaces in the kitchen, bathroom and other areas of the homeKey FeaturesTested and Proven to kill Sars-CoV-2 virusProvides long lasting freshnessKills 99% of viruses and bacteriaCuts through grease and soap scum for a deep cleanWhat's In the Box32 fl oz all purpose cleaner
All Purpose Cleaner Spray
All Purpose Cleaner Spray
₦ 61,945.99 ₦ 65,206.30 -5%
loader
Generic
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions. Specifications: Supercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise. Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue. Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving. It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass. This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc. Item Name: Desktop Vacuum Cleaner Material: Plastic Power Supply: Built-in 900mAh Battery (Included) Features: Multi-use, Mini, Desktop Cleaning, Capsule Shaped Size: 11cm x 6cm x 6cm/4.33" x 2.36" x 2.36" (Approx.) Notes: Due to the light and screen setting difference, the items color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement. Package Includes: 1 x Desktop Vacuum Cleaner 1 x USB CableKey FeaturesSupercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise.Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue.Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving.It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass.This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc.What's In the Box1 x Desktop Vacuum Cleaner1 x USB Cable
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
₦ 65,525.02 ₦ 68,973.70 -5%
loader
Generic
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:USB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.Item Name: Spray FanMaterial: ABSInput: 5V/1ABattery Capacity: 1200mAh (Included)Water Tank Capacity: 30mlAtomizing Particle: 0.3-0.7umFeatures: Rechargeable, Cooling Fan, , PortableBottom Diameter: 4cm/1.57" (Approx.)Height: 14.5cm/5.71" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Spray Fan1 x Charging CableKey FeaturesUSB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.What's In the Box1 x Spray Fan1 x Charging Cable
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
₦ 33,617.32 ₦ 35,386.65 -5%
Generic
Exfoliating Local Sponge X 2
This local sponge is a super exfoliating sponge. very appropriate to srub off dead skin off the body and face.appropriate for new born ans adult to reveal fresh and beautiful skin.makes the skin bright, clear and renewed.Key FeaturesExfoliate and renews the skinIncreases the lather of the body washleaves the skin silky and smoothSoak the kankan in water over night before first usefor effectiveness change sponge after 3 or 4 monthsNet enclosed for used netWhat's In the BoxA Pack of 2 sponges and storage net included.
Exfoliating Local Sponge X 2
Exfoliating Local Sponge X 2
₦ 4,425.86 ₦ 4,658.80 -5%
loader
Generic
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications: One-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.Cleaning of the dust box:(Dirt may be blown out of the inlet, so please empty the dust box after each use.)1. The dust box is located at the bottom of the machine, pull the plug to turn outward.2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth.3. Place the dust box back into the machine. Item Name: Vacuum Cleaner RobotMaterial: PlasticWorking Time: About 100 MinutesCharging Time: About 150 MinutesBattery Capacity: 1200mAh 18650 Battery (Included)Cleaning Area: 150 Square MetersWorking Voltage: 3.7VRated Power: 3WDust Box Capacity: About 400mlFeatures: Rechargeable, Auto, Anti-drop, Low NoiseSize: 26cm x 27cm x 6.8cm/10.24" x 10.63" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x DishclothKey FeaturesOne-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.What's In the Box1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x Dishcloth
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
₦ 181,555.88 ₦ 191,111.45 -5%
loader
Generic
OB12 Automatic Induction Electric Cleaning Robot USB-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:With 1500Pa strong suction features, it has high efficiency of lifting dust from floors. Supersonic battery core makes the suction power keep last and never drop.Using automatic induction, the sweeping robot turns randomly when encountering obstacles. 4cm Ultra-thin body can clean all areas without dead ends.Made of high quality fireproof ABS material, the cleaning robot is reliable and durable.The diameter of the product is 24.8cm and the height is 4cm.It is perfect for flat floor such as marble, ceramic tile, wood floor, etc.Item Name: Cleaning RobotMaterial: Fireproof ABSModel: OB12Motor Power: 9WDust Box Capacity: 110MLNoise: ≤55dB(A)Suction: 1500PaWorking Time: 80MinCharging Time: 4 Hours: 3.7VBattery Capacity: 2400mAhBattery: Build-in Battery (Included)Color: Black, White Features: Automatic Induction, 3 In 1, Ultra-thinSize Details: Size: 24.8cm x 24.8cm x 4cm/9.77" x 9.77" x 1.58" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Cleaning Robot2 x Brushes1 x Cleaning Cloth 1 x USB Charging Cable1 x User Manual1 x ScrewdriverKey FeaturesWith 1500Pa strong suction features, it has high efficiency of lifting dust from floors. Supersonic battery core makes the suction power keep last and never drop.Using automatic induction, the sweeping robot turns randomly when encountering obstacles. 4cm Ultra-thin body can clean all areas without dead ends.Made of high quality fireproof ABS material, the cleaning robot is reliable and durable.The diameter of the product is 24.8cm and the height is 4cm.It is perfect for flat floor such as marble, ceramic tile, wood floor, etc.What's In the Box1 x Cleaning Robot2 x Brushes1 x Cleaning Cloth1 x USB Charging Cable1 x User Manual1 x Screwdriver
OB12 Automatic Induction Electric Cleaning Robot USB-Black
OB12 Automatic Induction Electric Cleaning Robot USB-Black
₦ 155,464.12 ₦ 163,646.44 -5%
Purit
ANTI-BACTERIAL ANTI SEPTIC LIQUID (4LTRS)
Purity is specially formulated to deliver highly effective elimination of bacteria and other germs. It is mild on the skin and guarantees all day long protection.Use age: Midwifery- Postnatal - Babycare.1 capful to a litre of water - Nursery & sick room2 capful of a litre of water - Sterilization of surgical instruments.1 in 6 aqueous dilution - First aid for cut,grazes, minor burns & bites2 capful to a litre of water - Bathing1/2 -1 capful of the bath.Key FeaturesGentle on skinTough on germsCleanses & disinfectsFirst aid and hospital useHousehold and personal hygieneWhat's In the BoxPurit anti septic liquid
ANTI-BACTERIAL ANTI SEPTIC LIQUID (4LTRS)
ANTI-BACTERIAL ANTI SEPTIC LIQUID (4LTRS)
₦ 13,277.56 ₦ 13,976.38 -5%
loader
915 Generation
Durable Multi Portable Basins Waterproof Collapsible Sink
Detailed Information About The Product:Scenes: outdoor camping, home, fishing, car, etc.With sturdy handles.Large and sturdy enough to hold 10L water.Extremely easily and fast set up and fold down.Can be put in a small and ultra-light bag, easy for carrying and storage.color:Photo colorMaterial:PVCsize:About 25 x 22cmPackage Contents:1 x Camping Foldable BucketOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have anyeas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityCamping BucketFolding BucketCamping Foldable Round BucketCamping EquipmentOutdoor Camping BucketThe details are as described aboveWhat's In the Box1 x Camping Foldable Bucket
Durable Multi Portable Basins Waterproof Collapsible Sink
Durable Multi Portable Basins Waterproof Collapsible Sink
₦ 35,454.76 ₦ 37,320.80 -5%
loader
Fashion
Magnetic Window Glass Cleaner Wiper
Welcome to my shop we are factory direct sales s. There are many excellent products in my store. Please use this category to see more information. I wish you a happy shopping! We adhere to the business philosophy of customer first, provide customers with high-quality products and preferential prices, strive to do our best and choose satisfactory products for you. Finally, I wish you a happy shopping in our store, thank you! Thank you very much for your invitation. All dimensions are measured manually, and there may be a deviation of 1-2cm. Due to different screen displays, there may be color errors,Due to differences in light and screen settings, the color of the item may be slightly different from the picture.Due to the difference of manual measurement, please allow the size to vary slightly.Origin:CN(Origin)Model Number:Magnetic Window CleanerMaterial:Plastic ABS + MagnetType:Plastic + Rubber + MagnetFeatures 1:Clean inside and outside window at the same timeFeatures 2:Stay in your room to clean the outside window, ensuring your safetyFeatures 3:Double sided design with strong magnetFeatures 4:applicable glass thicknesses optionalFeatures 5:Built-in water storage sponge, no need to repeat waterFeatures 6:2 meters long safety rope designFeatures 7:Double magnet device, wipe the glass as you likeKey FeaturesOrigin:CN(Origin)Model Number:Magnetic Window CleanerMaterial:Plastic ABS + MagnetType:Plastic + Rubber + MagnetFeatures 1:Clean inside and outside window at the same timeFeatures 2:Stay in your room to clean the outside window, ensuring your safetyFeatures 3:Double sided design with strong magnetFeatures 4:applicable glass thicknesses optionalFeatures 5:Built-in water storage sponge, no need to repeat waterFeatures 6:2 meters long safety rope designFeatures 7:Double magnet device, wipe the glass as you likeWhat's In the Box1X Magnetic Window Glass Cleaner Wiper
Magnetic Window Glass Cleaner Wiper
Magnetic Window Glass Cleaner Wiper
₦ 109,799.53 ₦ 115,578.45 -5%
Jumia Bundles
All Purpose Cleanings
buy this which comes with Flat scourers for your pots and pans, Iron sponges for your Pots, Soap Pads for your Taps, tiles sinks, table, slabs etc.SCORING Pads Pots/ Pans/Ovens/Sink Cleaning Sponge . Sponge Scourers pads is ideal for washing, scouring and wiping. A must have at home, in the kitchen and in the office. Get yours from rehmie today!. Make use of these iron cleaning sponges today and clean your pots, tiles, kettles and sinks with it and it how clean all your utensils will look now using our iron soapy spongesKey Featuresstrong Ideal For WashingFor scouringFor WashingFor WipingEasy to use
All Purpose Cleanings
All Purpose Cleanings
₦ 8,580.09 ₦ 9,031.67 -5%
loader
Generic
Smart Robot Auto Vacuum Floor Carpet Cleaner Sweeper Machine Mop Brush Cleaning White
Package Included: 1 x Vacuum Cleaner Robot 1 x Brush 1 x USB Cable Features: Super Strong Suction. Automatically move and clean the floor. Will Automatically change direction when meet walls and obstacles. Flexible move, with large dust garbage box. Universal driving, sweeping the floor (no need for dust absorbing paper) Specifications: Material: ABS+Electronic Component : Black/White(Optional) Product specifications: 23 × 23 × 6 : 3.7V 1500MAH Working time: about 100 minutes Charging time: about 150 minutes Cleaning area: 150m2 Applicable to the ground: flat ground such as marble, tile, wooden floor, etc. Function: One-button start, sweeping, mopping, vacuum cleaner, USB charging, universal driving, automatic avoidance obstacles, anti-drop, low noise, intimate, low repetition, high coverage Operation Mode: Note! ! ! The product needs to open the rotating pulley cover at the bottom to be used normally. 1. After receiving the product, please charge the sweeper for 1 hour before using it normally. The is sufficient and the suction effect is better. 2. Switch mode: Press the host switch , and the sweeper enters the working mode working lamp to light up . Press the host switch again and turn off the sweeper. 3. Charging mode: Connect the Micro USB head of the USB cable to the charging port of the sweeper and connect the USB head to the converter for charging . 4. Charge Status: The charging indicator light is on , indicating that the charging is charged and the OFF indicates that the charging is complete and the general charging time is about 2-3 hours . Cleaning of the Dust Box: (Dirt may be blown out of the inlet, so please empty the dust box after each use.) 1. The dust box is located at the bottom of the machine, pull the plug to turn outward. 2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth. 3. Place the dust box back into the machine. Warning: 1. For safety reasons, this product should be operated by people with physical and mental health and over 14 years of age. 2. This product is not waterproof, do not let the product contact any and shallow water, away from the source of . 3. It is forbidden to use in the suspended environment, such as rooftop, staircase, duplex house and so on. 4. When the product is at work, please take care of your family and pets to prevent falling, stampede and injuries. 5. The product uses universal design, when encountered in front of obstacles, the opportunity to change direction. 6. Stop charging when the red light goes out, prevent overcharge, affect service life and accident. 7. If the product appears abnormal phenomena, such as odour, , abnormal noise, excessive fever. Please stop using immediately. Notice: - Please allow 1-3CM differs due to manual measurement. - Due to the different display and different light, the picture may not reflect the actual of the item. Thanks for your understanding. a a a a a Key FeaturesMaterial: ABS+Electronic Component: Black/White(Optional)Product specifications: 23 × 23 × 6 : 3.7V 1500MAHWorking time: about 100 minutesCharging time: about 150 minutesCleaning area: 150m2Super Strong SuctionEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Vacuum Cleaner Robot 1 x Brush 1 x USB Cable

Featured Products

View All

Top Stores : Brand Directory