×

Download App Today & Register Now

Get Flat ₦100 on your RM Wallet*

Buy Cleaning Tools Products online in Nigeria

Cleaning Tools Products

icon_filter
Filters
Mopar
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
To keep your home clean or & nbsp;germ free without having to touch the dirty wiping cloth, you can opt for this utilitarian PVC Magic Mop at & nbsp; at an affordable price. This magic mop will help you to clean your home in a hassle free manner and without creating a mess. You can now clean the floors without stretching or bending as this mop comes with a long rod for convenience. This cleaning tool will help you keep your home spic and span.This Mop is made of good quality PVC and is high on quality and utility. The PVC makes this mop and bucket set durable and long-lasting. The mop and bucket is also compact in size and can be stored anywhere when not in use. The handle of the easy to clean mop is ergonomically designed and that ensures a firm grip.The PVC Magic Mop can help you clean with optimum efficiency. The mop can rotate 360 degrees that allows you to clean areas that are usually difficult to reach. As the mop head can conveniently squeeze out water on its own, you do not have to rinse it yourself.
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
Durable And Rotating Spin Mop With Bucket And Mop Head (g)
₦ 21,780.00 ₦ 22,000.00 -1%
WOODEN
6pcs Scrubbing Hard Brush
Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing. Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.Scrubbing & nbsp;brush & nbsp;helps you to clean hard floors or surfaces. Unlike a broom, which has soft bristles to sweep dirt away , it has hard bristles for brushing.
6pcs Scrubbing Hard Brush
6pcs Scrubbing Hard Brush
₦ 9,900.00 ₦ 10,000.00 -1%
Plastic
High Quality Wooden Broom For Cleaning and Sweeping - Multi-color
Plastic brooms are incredibly versatile cleaning tools. They can be & nbsp;used & nbsp;both indoors and outdoors, making them a go-to choice for many cleaning tasks. Whether you're sweeping the kitchen floor, the driveway, or the patio, a plastic broom can handle the job with ease The plastic broom can be used for home, offices, bathroom and toilet. It is more durable and easy to use than the old wooden Brooms & nbsp;
Plastic
Dust Pan
For home, as souvenir & nbsp;at parties, birthday, wedding etc. What more! & nbsp; Keep your environment in tip-top shape with this dust pan! Made of durable plastic, this dust pan is built to withstand repeated use in virtually any setting. The unique design is tough and sturdy, yet still flexible, offering greater versatility of use. This dust pan will not warp or bend over time. In addition, this dust pan has a thin front edge to allow for maximum pick-up. This convenient feature prevents that pesky line of dirt from being left behind after sweeping up. There's also a built-in hanging slot which ensures efficient, space-saving storage when the dust pan is not in use. Offering high-quality function at an economical price, this Continental dust pan is a must-have addition to any venue. & nbsp;
Dust Pan
Dust Pan
₦ 990.00 ₦ 1,000.00 -1%
Generic
Magic X-type Microfiber Floor Mop 360 Degree Flat Wood Ceramic Tiles Cle
Specifications: Material: Microfiber+ABS+Stainless steel Handle Size: 140cm/55" Mop Pad Size: 37x13cm/14.57"x5.2" [Conversion: 1cm=0.3937 inch, 1inch=2.54 cm] Features: ◆Made from strong, but light plastic. Extra long, easy to extend handle for cleaning hard-to places in the kitchen, under the couch, up on windows. Lightweight design for dusting and mopping under the couch and on walls. ◆Plastic mop handle and large strong head. Rotating 360 n head, industrial grade mop swivels. ◆Simulated wringing. One hand holds the handle of the floor mop, the hand easily push down the floor mop of Lower rod to wring out. Sliding repeatedly, the floor mop head can easily be screwed dry. ◆Perfect for cleaning all types of floors, including laminate, hardwood, tile, vinyl, , and concrete. Package Included: 1 x Floor Mop Note: -Due to different producing batches, product details might be a little different. If you mind the difference, please buy it carefully. -Please allow 1-3CM differs due to manual measurement. -Due to the different display and different light, the picture may not reflect the actual of the item. Thanks for your understanding. If you have any questions,please link us. Wish you have a happy shopping time! Key FeaturesEasy to useHigh quality and InexpensiveExquisite WorkmanshipDurable in useWell MadeEnjoy Great Popularity Among the PeopleSave your MoneyBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Floor Mop
loader
Generic
275ml Stainless Auto Handsfree Sensor Touchless Soap Dispenser Kitchen Bathroom Red
275ml Stainless Auto Handsfree Sensor Touchless Soap Dispenser Kitchen Bathroom a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Automatic Soap Dispenser 1 x Wall Hanging 1 x USB Charging Cable
loader
Generic
Creative Household Cartoon Professional Cleaning Cup Brush
Feature: and high quality Cute,Eco-Friendly,convenient Cartoon and vertical design,makes your kitchen more beautiful Description: Material: ABS+sponge Size: length 20cm(7.87in) Sponge diameter: 4.5cm(1.77in) Weight: 45g : (random when shipped) Package: 1 x Cup Brush a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Cup Brush
Creative Household Cartoon Professional Cleaning Cup Brush
Creative Household Cartoon Professional Cleaning Cup Brush
₦ 39,816.70 ₦ 41,912.32 -5%
Home Etcetera
Neutral Oven Glove
Description This Neutral Oven Glove from Home Etc is heat resistant which makes it perfect for all cooking uses. Please not allow the glove to touch naked flames or heat element.Key FeaturesHeat resistant18 x 32 cmNot to touch naked flames or heat elementPrevent burns to the arm from the ovenKitchen essentialWhat's In the Box1 x Neutral Oven Glove, Home Etc
Neutral Oven Glove
Neutral Oven Glove
₦ 15,051.11 ₦ 15,843.27 -5%
loader
Generic
Luggage Protective Cover For 30-32 Inch XL
Luggage Protective Cover1. Material: stretch fabric2. Function: breathable, wear-resistant3. Applicable gender: neutral / both men and women4. Hook and loop fastener design at the bottom, easy to install and disassemble5. Double-layer thickened fabric, high elasticity and more wear-resistant6. Digital printing, bright colors, not easy to fadeKey FeaturesLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverLuggage Protective CoverWhat's In the Box1 x package
Luggage Protective Cover For 30-32 Inch XL
Luggage Protective Cover For 30-32 Inch XL
₦ 48,141.16 ₦ 50,674.90 -5%
Ariel
Stain Remover Powder X6
Ariel formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try Ariel multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Ariel formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try Ariel multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Key FeaturesFirst-time stain removal, even in a cold wash 30°cIxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester
Stain Remover Powder X6
Stain Remover Powder X6
₦ 79,633.42 ₦ 83,824.65 -5%
loader
Generic
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
Description:The cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.This vegetable cleaning brush adopts hard silicone bristles, which can reach every corner and clean thoroughly.It is constructed of silicone material.The length of this vegetable cleaning brush is 10cm and width is 10cm.This vegetable cleaning brush is suitable for potatoes, sweet potatoes, carrots, corn and more.Item Name: Cleaning BrushMaterial: SiliconeColor: Yellow, Green, White, Purple, BlueFeatures: Multifunctional, Effective, BendableSize Details:10cm x 10cm/3.94" x 3.94" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Cleaning BrushKey FeaturesThe cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.Designed with finger clip, this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.The cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off because it is designed with finger clip.The cleaning brush is designed with finger clip, so it fits perfectly and comfortably in the palm of your hand and it will not slip off.The finger clip design of this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
₦ 6,087.55 ₦ 6,407.95 -5%
Generic
3 Piece Set Silicone Toilet Brush And Holder
The toilet brush head is water-repellent, eliminating the hassle of dripping. Selected materials ensure quality and longevity. the premium silicone toilet brush head has excellent durability. Cleaning time savings: Ergonomic handles make cleaning easier and reduce cleaning time. Comfortable, non-slip handle design, pack with stable and breathable mounting base, it is well ventilated. The simple and beautiful design is tailored to your bathroom. Lighter packaging makes life more environmentally friendly,more convenient to use, saving space, energy saving and environmental protection.Material: ABS+ TPRSize:40.6×14.3×5.6cmPackage Included:3 x Toilet Brush1 x Toilet Brush Holder.The toilet brush head is water-repellent, eliminating the hassle of dripping. Selected materials ensure quality and longevity. the premium silicone toilet brush head has excellent durability. Cleaning time savings: Ergonomic handles make cleaning easier and reduce cleaning time. Comfortable, non-slip handle design, pack with stable and breathable mounting base, it is well ventilated. The simple and beautiful design is tailored to your bathroom. Lighter packaging makes life more environmentally friendly,more convenient to use, saving space, energy saving and environmental protection.Material: ABS+ TPRSize:40.6×14.3×5.6cmPackage Included:3 x Toilet Brush1 x Toilet Brush HolderKey FeaturesMaterial : ABS + TPRAffordable Durable Easy to useLong lasting
3 Piece Set Silicone Toilet Brush And Holder
3 Piece Set Silicone Toilet Brush And Holder
₦ 26,555.13 ₦ 27,952.77 -5%
loader
Generic
Electric Clothes Lint Remover Hairball Trimmer Sweaters Carpet Fluff
Similar Items Description Electric clothes lint Remover Hairball Trimmer Sweaters Carpet Fluff Specifications: Item type: Hair Ball Trimmer :White Model: MQXJIQ01KL Size:145x62x65mm/5.66x2.42x2.54inch Input : 5V--1A Rated voltage: 3.7V Rated :2W (1cm=10mm=0.39inch) Measurement Details in the attached picture. Package included: 1x Hair Ball Trimmer 1x USB Cable 1x clean brush 1x English manual Features: -100% and high quality. -0.35mm micro-arc net to avoid pressing the net deformation to cause lifting clothes -5 leaf whirlwind floating head Increases shear efficiency and efficiently removes hair balls. -Negative centrifugal fan New design, stable and reliable suction. -Anti-backflow air duct design Avoid hair ball dander back to stain clothes. -Double safety protection device Disassemble the head cover or the ball cage automatically off. Notice -Please allow slight deviation of measurement due to manual measurement. -Due to different monitors and different light, the picture may not reflect the actual of the item. -Please consider the actual sizes in the listing as the pictures are generally enlarged to show detail. Ifyouhaveanyquestions,pleasecontactus. Wishyouhaveahappyshopping time. Detail Image a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1x Hair Ball Trimmer 1x USB Cable 1x clean brush 1x English manual
loader
Generic
3IN1 13L Smart Touch-free Motion/Knock/Touch Sensor Dustbin Rubbish Waste Pink USB Rechargeable
Features:[3 OPEN MODES: Infrared touchless sensor, Knock touch sensor and Manual mode. Using the most advanced sensor, can be sensed within 30cm, Hands or objects leave for 7 seconds, automatically close the cover, do not leave without closing.[TOUCHLESS SMART TRASH CAN: The motion sensor of the smart trash can automatically opens the lid. A precise motor and planetary gear system produces smooth, steady , you won't hear a thing.[KNOCK TOUCH SENSOR: The trash can with Intelligent knock touch, vibration sensor to open the cover, with the foot gently knock can open the cover, is very convenient and practical.[USB RECHARGEABLE: Our advanced smart trash can use usb charging, more energy-saving than -powered trash can, more convenient, ultra-low energy consumption.[EASY TO USE: You can use the hand sensor switch; You can touch it with your foot; Or you can press the button to turn on garbage can.[APPLICATION: Can be placed in the living room, kitchen, bedroom, bathroom, dormitory, gym and more. Induction trash can, beautiful, practical and easy to clean, create a simple lifestyle.Specification:Capacity: 13LMaterial: ABS,: White, Blue2 Optional: Powered, USB RechargeableNOTE:1. Please allow slight dimension difference due to manual measurement.2. Due to the light and screen difference, the item's may be slightly different from the pictures. Thanks for your understanding.Package Included:1 x 3-in-1 Smart Trash Can1 x Charging Cable( With USB Rechargeable Type) a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x 3-in-1 Smart Trash Can 1 x Charging Cable( With USB Rechargeable Type)
loader
Generic
Household Foldable Mop Bucket Home Kitchen Floor Cleaning Tools Portable Wash Basin
Similar Items Description Household Foldable Mop Bucket Home Kitchen Floor Cleaning Tools Portable Wash Basin Specifications: Model: E11517 Material: +TPR : Gray White Size: unfold: 43*28.4*18.3cm (16.9"x11.1"x7.2") fold: 47.6*28.4*7.7cm (18.7"x11.1"x3") Features: - With handle, very convenient to use. - Suitable for many types mop, tit can be folded when not in use, which can effectively saving space. - Suitable Place: For all camping, outdoor, , hiking, washing car, kitchen, family storage, bathroom, laundry room, garden and yard. Package included: 1 X foldable bucket (the mop in the picture NOT included) Note: Please allow slight 1-3cm difference due to manual measurement and a little for different display setting. The pictures are for reference, please make the object as the standard. Thank you for your understanding! Detail Image a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the BoxPackage included: 1 X foldable bucket (the mop in the picture NOT included)
loader
Generic
Elastic Wear-resistant Luggage Protective Cover M
Elastic Wear-resistant Luggage Protective Cover1. Material: polyester and spandex2. Function: Breathable and wear-resistant3. Suitable for gender: gender-neutral / male and female4. Side invisible zipper mouth, regardless of left and right handle5. Double layer thickened fabric, high elastic and more wear-resistant6. It is convenient to insert points and not easy to break7. Resin zipper, tight bite, smooth pull8. Four-wire seam, strong and not open9. Digital printing, bright colors, not easy to fade10. Size: S for 18-21 inches, M for 22-24 inches, L for 25-28 inches, XL for 29-32 inches11. Weight: S 240 g, M 310 g, L 370 g, XL 440 gKey FeaturesElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverWhat's In the Box1 x package
Elastic Wear-resistant Luggage Protective Cover M
Elastic Wear-resistant Luggage Protective Cover M
₦ 44,785.80 ₦ 47,142.95 -5%
loader
Generic
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
Detailed Information About The Product:as description and high qualityMade of high quality materials for durabilityStrong absorption, gentle cleaningReusable, washable, machine washablesize:13x13cm Material:fibercolour:GrayPackage Contents:2 x cleaning clothOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.20232. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityas description and high qualityMade of high quality materials for durabilityStrong absorption, gentle cleaningReusable, washable, machine washableThe details are as described aboveWhat's In the Box2 x cleaning cloth
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
2Pcs Mop Pads for LG Steam Mop Cloth A9 Mopping Machine
₦ 12,862.15 ₦ 13,539.10 -5%
loader
Generic
Brush USB Rechargeable Electric Shoe Shine
Brush USB Rechargeable Electric Shoe ShineModel Number:Electric Shoes Polisher1. Product name: Electric leather care device2. Color: Charging black, charging gold3. Product weight: 752g4. Product size: 78.9X32X100mm5. Power mode: USB charging6. Rated power: 100W7. Rated frequency: 50Hz8. Uses: Used for daily leather care and shoes polishing9. Packing list: Host, dusting brush, grindstone, USB cable, oiling brush X2, polishing brush, brightening brush, shoe polish, instruction manualKey FeaturesProduct name: Electric leather care deviceColor: Charging black, charging goldProduct weight: 752gProduct size: 78.9X32X100mmPower mode: USB chargingWhat's In the Box1 x package
Brush USB Rechargeable Electric Shoe Shine
Brush USB Rechargeable Electric Shoe Shine
₦ 140,109.44 ₦ 147,483.62 -5%
loader
Generic
Microfiber Steam Mop Cover For Sienna
Microfiber Steam Mop Cover For SiennaFeature:Eco-FriendlyProduction:Scouring Pad1. Product Name: Steam mop replacement cloth2. Product Category: Mop Accessories3. Material: Fiber4. Applicable object: steam mop6. Size: 27.5x22.5cm7. Weight: 47g / piece8. Features: high water absorption, strong decontamination, no hair removal, long life, easy to clean, no lint, etc.Key FeaturesProduction:Scouring PadProduct Name: Steam mop replacement clothProduct Category: Mop AccessoriesMaterial: FiberApplicable object: steam mopWhat's In the Box1 x package
Microfiber Steam Mop Cover For Sienna
Microfiber Steam Mop Cover For Sienna
₦ 26,027.86 ₦ 27,397.75 -5%
loader
Generic
Plastic Leaf Scraper Kitchen Cleaning Tool Pot Bowl Pan Scraper
Description: Thisisascraperforkitchenuse. Itcanbeusedtoshavetheresidualoilfromthefryingpan,shavethestickyricefromthethericecooker,etc. Thelovelyleafshapemadeitdifferentfromtraditionalscrapers. Thepracticalandeasytousescraperwouldbegoodhelperforhousewives. Feature: Type:Scraper Shape: Green leaf Material:PPplastic Size:13.5*7.5cm Package:3xLeafscrapers Note: Productsandimagesmayexistchromaticaberration,pleaseunderstanding! Comparethedetailsizeswithyours,pleaseallow1-2cmdiffersduetomanualmeasurement! a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box3 x Leaf scrapers
loader
Generic
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
Multipurpose Tanning Mitt Set: This tanning glove set is perfect for different parts of your body, including 1 self-tanning glove, 1 mini tanning glove, a self-tanning back applicator and 1 body exfoliating glove .Ease of use: All four parts have different functions. The thumb of the grooming tanning glove allows for easy control. Self-tanning mitt back application makes it easier to reach the back. Mini tanning mitts easier to reach hard-to- areas.Skin-Friendly Soft Tanning Gloves: These self-tanning gloves are carefully from high-quality material, with perfect stitching structure, bringing you a super . The thumb of the self-tanning glove applicator fits perfectly in the palm of your hand without slipping off, it is easy to apply the evenly on your skin.MULTI-: The self-tanning glove applicator can be used with all tanning lotions, creams, mousses, sunscreens and sprays. Self-tanning gloves protect your hands from the without having to apply lotion on your hands.EASY TO CLEAN: After using the self-tanning mitt, dry it in water with your clothes, it can be washed with mild soap and warm water and sent to dry.Item Type: Tanning Applicatorcolor: as shownMaterial: Super Soft Cloth + Sponge + Waterproof MembraneSmall Gloves: . 9 X 8 Cm / 3.54 X 3.15 Inches Gloves: . 21.5 X 16.5 Cm / 8.3 X 5.1 InchesBack Applicator: . 82x 11cm / 32.3 X 4.3inFunction: When Tanning, It Can Help Spread Oil, Lotion, Mousse Evenly, Without WastingFeatures: ReusableCleaning: Rinse With Water And DryPackage Contents:1 x Thumb Glove1 x Mini Gloves1 x Exfoliating Gloves1 x Double Side Pull Back StripOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
Tanning Oiler Gloves Set Sunless Tanning Applicator Body
₦ 24,366.17 ₦ 25,648.60 -5%
loader
Generic
Fitness Equipment Dust Cover
Fitness Equipment Dust Cover1. Material: Oxford cloth 2. Suitable for treadmills, joggers and other fitness equipment. 3. Easy to store and does not take up space. 4. Dustproof and sunscreen, durable. 5. Dimensions: 95x75x160cm, 80x60x150cmKey FeaturesFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverFitness Equipment Dust CoverWhat's In the Box1 x package
Fitness Equipment Dust Cover
Fitness Equipment Dust Cover
₦ 80,879.69 ₦ 85,136.52 -5%
loader
Generic
Chair Waterproof Cover 89x89x120/89cm
Chair Waterproof Cover1. The main component content of the fabric: waterproof 210D Oxford cloth2. Color: black outside and silver inside3. Weight: 300 grams4. Size: 89x89x120/89cm5. 210D Oxford cloth, tear-resistant, easy to cleanKey FeaturesChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverChair Waterproof CoverWhat's In the Box1 x package
Chair Waterproof Cover 89x89x120/89cm
Chair Waterproof Cover 89x89x120/89cm
₦ 66,899.10 ₦ 70,420.10 -5%
loader
Generic
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
Features:[High-quality Material]: Made of superb TPR material, which is flexible, reliable and not easy to deform.[132 Holes & 196 Blocking Posts]: Composed fo 132 holes and 196 blocking posts of different length, it can effectively intercept hair residues, leach impurities, and protect sewers from clogging.[Multipurpose Drain Cover]: Applicable for most o-utlet of sinks, showers or tubs drain. [Creative Design]: Sucker at the bottom, anti-slip and fixed, and easily pick up. Cleaning your hair and not dirty hands.[Easy Installation & Cleaning]: Just put the hair stopper for shower drain into the corresponding sink. It can be washed by water, but it is better to add some detergent when there is oil. Specifications:Material: TRPColor: Blue, Green, Black, Red(optional)Item Diameter: 150mm/5.9inPackage Size: 150*150*10mm/5.9*5.9*0.4in(L*W*H)Package Weight: 44g/1.6ozPacking List:1*Sink Leaching CoverKey FeaturesSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverSink Anti-block Cover Hair Catcher Reliable TPR Leaching Cover Easy Installation and Cleaning For Kitchen Bathroom and Bath tub Hair Stopper Shower Drain CoverWhat's In the Box1xSink Leaching Cover,
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
Sink Anti-block Cover Hair Catcher Reliable TPR Leaching
₦ 6,646.77 ₦ 6,996.60 -5%
loader
Generic
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
Thick Elastic Luggage Dust Cover1. Made of high-quality polyester material, comfortable and wear-resistant2. Good elasticity, easy installation3. Precise hole , does not affect the normal use of the suitcase4. Various sizes and styles, you can choose according to your needs5. Material: Polyester6. Function: breathable, elastic, durable, boardableLining texture: polyester7. Size: S (for 20-23 inches), M (for 24-26 inches), L (for 27-29 inches), XL (for 30-32 inches), XXL (for 32-35 inches)8. Note: Only the dust jacket will be shipped, nothing else!Key FeaturesThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverThick Elastic Luggage Dust CoverWhat's In the Box1 x package
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
Thick Elastic Luggage Dust Cover XXL (32-35 Inches)
₦ 41,238.74 ₦ 43,409.20 -5%
loader
Generic
Low Toe Shoe Covers Men And Women Non-Slip Thick Bottom Flip Buckle Waterproof Rain Boots, Size: 40/41(White)
1. Applicable age: Adult2. Applicable gender: Both men and women3. Tube height: Low tube4. Thickness: Thicken5. Heel height: Flat heel6. Pattern: Solid color7. Upper material: PVCKey FeaturesLow ToeShoe CoversMen AndWomen Non-SlipThick BottomFlip BuckleWhat's In the BoxLow Toe Shoe Covers Men And Women Non-Slip Thick Bottom Flip Buckle Waterproof Rain Boots, Size: 40/41(White)
Generic
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
Dry your freshly cleaned clothes naturally outside in the sun or in your laundry room on a rainy day using this elegant airer.Made from steel with a clean powder coated finish, the airer is strong and secure, so you can simply unfold it ready for use.As well as three tiers of space, it has four side wings so you can dry clothes on hangers and move them to the wardrobe afterwards.The racks are made from tough steel with a powder coated finish which will prevent your clothes from slipping off as they dry.The airer measures 63 x 45w x 138h cm when opened and has a huge amount of drying space, so you can air a large load of laundryExtended to a height of 138cmFolds Flat for easy storageAuto lock Indoor and outdoor drying RackLarge deluxe size and compact design allows the drying of long items Folding compact design which makes it easily to stored when folded and easy to use locking mechanismLight weight and extra strong with coat hanger holders14m drying spaceSize when open 60w x 45(d)x138(h)cmFolded size : 63w X 8 (d) X 74hKey FeaturesExtended to a height of 138cmFolds Flat for easy storageAuto lock Indoor and outdoor drying RackLarge deluxe size and compact design allows the drying of long items Folding compact design which makes it easily to stored when folded and easy to use locking mechanismLight weight and extra strong with coat hanger holders14m drying spaceSize when open 60w x 45(d)x138(h)cmFolded size : 63w X 8 (d) X 74h
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
Deluxe 3Tier Tubular Cloth Airer Laundry Dryer
₦ 70,781.72 ₦ 74,507.07 -5%
Tchibo
Dish Washing Brush, Blue
Easy to wash: The dirt does not stick to the surface thanks to the rubber bristles of the dishwasher, the residues are easily cleaned. It also makes it possible to clean delicate surfaces while hand rinsing. Key Highlights: Rubber brush bristles Dirt does not stick and residue is easily cleaned Makes it possible to clean delicate surfaces while hand rinsing. Value for money Key FeaturesRubber brush bristles Dirt does not stick and residue is easily cleanedMakes it possible to clean delicate surfaces while hand rinsing.Value for moneyWhat's In the Box1 X Dish Washing Brush, Blue
Dish Washing Brush, Blue
Dish Washing Brush, Blue
₦ 15,929.89 ₦ 16,768.30 -5%
loader
Generic
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions. Specifications: Supercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise. Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue. Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving. It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass. This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc. Item Name: Desktop Vacuum Cleaner Material: Plastic Power Supply: Built-in 900mAh Battery (Included) Features: Multi-use, Mini, Desktop Cleaning, Capsule Shaped Size: 11cm x 6cm x 6cm/4.33" x 2.36" x 2.36" (Approx.) Notes: Due to the light and screen setting difference, the items color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement. Package Includes: 1 x Desktop Vacuum Cleaner 1 x USB CableKey FeaturesSupercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise.Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue.Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving.It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass.This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc.What's In the Box1 x Desktop Vacuum Cleaner1 x USB Cable
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
₦ 65,525.02 ₦ 68,973.70 -5%
loader
Generic
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:USB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.Item Name: Spray FanMaterial: ABSInput: 5V/1ABattery Capacity: 1200mAh (Included)Water Tank Capacity: 30mlAtomizing Particle: 0.3-0.7umFeatures: Rechargeable, Cooling Fan, , PortableBottom Diameter: 4cm/1.57" (Approx.)Height: 14.5cm/5.71" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Spray Fan1 x Charging CableKey FeaturesUSB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.What's In the Box1 x Spray Fan1 x Charging Cable
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
30ml Portable Handheld Rechargeable Water Cold Spray-Pink
₦ 33,617.32 ₦ 35,386.65 -5%
loader
Generic
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications: One-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.Cleaning of the dust box:(Dirt may be blown out of the inlet, so please empty the dust box after each use.)1. The dust box is located at the bottom of the machine, pull the plug to turn outward.2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth.3. Place the dust box back into the machine. Item Name: Vacuum Cleaner RobotMaterial: PlasticWorking Time: About 100 MinutesCharging Time: About 150 MinutesBattery Capacity: 1200mAh 18650 Battery (Included)Cleaning Area: 150 Square MetersWorking Voltage: 3.7VRated Power: 3WDust Box Capacity: About 400mlFeatures: Rechargeable, Auto, Anti-drop, Low NoiseSize: 26cm x 27cm x 6.8cm/10.24" x 10.63" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x DishclothKey FeaturesOne-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.What's In the Box1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x Dishcloth
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-White
₦ 181,555.88 ₦ 191,111.45 -5%
loader
Generic
OB12 Automatic Induction Electric Cleaning Robot USB-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:With 1500Pa strong suction features, it has high efficiency of lifting dust from floors. Supersonic battery core makes the suction power keep last and never drop.Using automatic induction, the sweeping robot turns randomly when encountering obstacles. 4cm Ultra-thin body can clean all areas without dead ends.Made of high quality fireproof ABS material, the cleaning robot is reliable and durable.The diameter of the product is 24.8cm and the height is 4cm.It is perfect for flat floor such as marble, ceramic tile, wood floor, etc.Item Name: Cleaning RobotMaterial: Fireproof ABSModel: OB12Motor Power: 9WDust Box Capacity: 110MLNoise: ≤55dB(A)Suction: 1500PaWorking Time: 80MinCharging Time: 4 Hours: 3.7VBattery Capacity: 2400mAhBattery: Build-in Battery (Included)Color: Black, White Features: Automatic Induction, 3 In 1, Ultra-thinSize Details: Size: 24.8cm x 24.8cm x 4cm/9.77" x 9.77" x 1.58" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Cleaning Robot2 x Brushes1 x Cleaning Cloth 1 x USB Charging Cable1 x User Manual1 x ScrewdriverKey FeaturesWith 1500Pa strong suction features, it has high efficiency of lifting dust from floors. Supersonic battery core makes the suction power keep last and never drop.Using automatic induction, the sweeping robot turns randomly when encountering obstacles. 4cm Ultra-thin body can clean all areas without dead ends.Made of high quality fireproof ABS material, the cleaning robot is reliable and durable.The diameter of the product is 24.8cm and the height is 4cm.It is perfect for flat floor such as marble, ceramic tile, wood floor, etc.What's In the Box1 x Cleaning Robot2 x Brushes1 x Cleaning Cloth1 x USB Charging Cable1 x User Manual1 x Screwdriver
OB12 Automatic Induction Electric Cleaning Robot USB-Black
OB12 Automatic Induction Electric Cleaning Robot USB-Black
₦ 155,464.12 ₦ 163,646.44 -5%
loader
Generic
Smart Robot Auto Vacuum Floor Carpet Cleaner Sweeper Machine Mop Brush Cleaning White
Package Included: 1 x Vacuum Cleaner Robot 1 x Brush 1 x USB Cable Features: Super Strong Suction. Automatically move and clean the floor. Will Automatically change direction when meet walls and obstacles. Flexible move, with large dust garbage box. Universal driving, sweeping the floor (no need for dust absorbing paper) Specifications: Material: ABS+Electronic Component : Black/White(Optional) Product specifications: 23 × 23 × 6 : 3.7V 1500MAH Working time: about 100 minutes Charging time: about 150 minutes Cleaning area: 150m2 Applicable to the ground: flat ground such as marble, tile, wooden floor, etc. Function: One-button start, sweeping, mopping, vacuum cleaner, USB charging, universal driving, automatic avoidance obstacles, anti-drop, low noise, intimate, low repetition, high coverage Operation Mode: Note! ! ! The product needs to open the rotating pulley cover at the bottom to be used normally. 1. After receiving the product, please charge the sweeper for 1 hour before using it normally. The is sufficient and the suction effect is better. 2. Switch mode: Press the host switch , and the sweeper enters the working mode working lamp to light up . Press the host switch again and turn off the sweeper. 3. Charging mode: Connect the Micro USB head of the USB cable to the charging port of the sweeper and connect the USB head to the converter for charging . 4. Charge Status: The charging indicator light is on , indicating that the charging is charged and the OFF indicates that the charging is complete and the general charging time is about 2-3 hours . Cleaning of the Dust Box: (Dirt may be blown out of the inlet, so please empty the dust box after each use.) 1. The dust box is located at the bottom of the machine, pull the plug to turn outward. 2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth. 3. Place the dust box back into the machine. Warning: 1. For safety reasons, this product should be operated by people with physical and mental health and over 14 years of age. 2. This product is not waterproof, do not let the product contact any and shallow water, away from the source of . 3. It is forbidden to use in the suspended environment, such as rooftop, staircase, duplex house and so on. 4. When the product is at work, please take care of your family and pets to prevent falling, stampede and injuries. 5. The product uses universal design, when encountered in front of obstacles, the opportunity to change direction. 6. Stop charging when the red light goes out, prevent overcharge, affect service life and accident. 7. If the product appears abnormal phenomena, such as odour, , abnormal noise, excessive fever. Please stop using immediately. Notice: - Please allow 1-3CM differs due to manual measurement. - Due to the different display and different light, the picture may not reflect the actual of the item. Thanks for your understanding. a a a a a Key FeaturesMaterial: ABS+Electronic Component: Black/White(Optional)Product specifications: 23 × 23 × 6 : 3.7V 1500MAHWorking time: about 100 minutesCharging time: about 150 minutesCleaning area: 150m2Super Strong SuctionEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Vacuum Cleaner Robot 1 x Brush 1 x USB Cable
loader
Generic
ES03 3 In 1 Household Automatic Rechargeable Smart-Golden
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:The sweeper is made of ABS and metal, which is easy to use and install.It has the function of dust absorption, sweeping and mopping.It can clean most trash in you house like dust, hair and paper pieces.Item Name: Smart SweeperMaterial: ABS, MetalPower Supply: USBTiming Function: No TimingRated Voltage: 3.7 VWorking Voltage: 3.7VRated Power: 5WCleaning Route: RandomBattery Capacity: 1500mAh (Included)Working Time: 100 minutesCharging Time: 1.5 HoursSuction: 2000PaCleaning Area: 150 Square MetersFeatures: Automatic, Easy to Operate, RechargeableSize:32cm x 32cm x 6.8cm/12.6" x 12.6" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Smart Sweeper1 x Charging Cable1 x Cleaning Towel1 x Hair Brush1 x Cleaning BrushKey FeaturesThe sweeper is made of ABS and metal, which is easy to use and install.It has the function of dust absorption, sweeping and mopping.It can clean most trash in you house like dust, hair and paper pieces.What's In the Box1 x Smart Sweeper1 x Charging Cable1 x Cleaning Towel1 x Hair Brush1 x Cleaning Brush
ES03 3 In 1 Household Automatic Rechargeable Smart-Golden
ES03 3 In 1 Household Automatic Rechargeable Smart-Golden
₦ 209,980.42 ₦ 221,032.02 -5%
loader
Generic
1 Set 450ml Soap Dispenser Automatic Sensor Wide-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Designed with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.Item Name: Soap DispenserMaterial: ABSCapacity: 450mlBattery: 14500 Lithium-ion BatteryNoise Reduction: 40DbCharging Interface: Type-CWaterproof: IPX 4Features: Automatic Sensor, Non-touching, Low ConsumptionSize Details: 10cm x 7.9cm x 21cm/3.94" x 3.11" x 8.27" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Soap Dispenser1 x Charging CableKey FeaturesDesigned with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.What's In the Box1 x Soap Dispenser1 x Charging Cable
1 Set 450ml Soap Dispenser Automatic Sensor Wide-Pink
1 Set 450ml Soap Dispenser Automatic Sensor Wide-Pink
₦ 91,680.69 ₦ 96,505.99 -5%
loader
Generic
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-Blue
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications: One-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.Cleaning of the dust box:(Dirt may be blown out of the inlet, so please empty the dust box after each use.)1. The dust box is located at the bottom of the machine, pull the plug to turn outward.2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth.3. Place the dust box back into the machine. Item Name: Vacuum Cleaner RobotMaterial: PlasticWorking Time: About 100 MinutesCharging Time: About 150 MinutesBattery Capacity: 1200mAh 18650 Battery (Included)Cleaning Area: 150 Square MetersWorking Voltage: 3.7VRated Power: 3WDust Box Capacity: About 400mlFeatures: Rechargeable, Auto, Anti-drop, Low NoiseSize: 26cm x 27cm x 6.8cm/10.24" x 10.63" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x DishclothKey FeaturesOne-button start, easy to use.Sweeping, mopping, vacuuming at the same time. powered, can use for a long time.Automatic avoidance obstacles, do not miss the corner.Work with low noise, will not affect you when working or sleeping.What's In the Box1 x Vacuum Cleaner Robot1 x USB Cable1 x Manual1 x Dishcloth
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-Blue
Smart Auto Rechargeable Dry Wet Mop Sweeping Robot-Blue
₦ 182,961.93 ₦ 192,591.50 -5%
loader
Generic
1pcs Sweeping Brush Head Stiff Bristle Hard Outdoor Broom Garden Yard Stainless Steel -- 20cm / 30cm / 50cm 20cm
Product Description:1.20cm/30cm/50cm Sweeping Brush Head Without Handle.2.The Dustpan and Brush Store 10" Stiff Bassine Broom and Wooden Handle.3.A well made traditional item designed for use outdoor on patios and decking area's.4.Quick and Easy Assembly which gives a strong durable product.5.Easy Assembly - Less Than 30 Seconds!Size:S-20*7*7cm/7.87*2.76*2.76"M-30*7*7cm/11.81*2.76*2.76"L-50*7*7cm/19.69*2.76*2.76"Material: Wooden, Stainless SteelPackage included:1 x Sweeping Brush Head a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Sweeping Brush Head
loader
Generic
IPX7 Waterproof Electric Toothbrush One-button Start-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Superb and professional workmanship makes this electric toothbrush anti-dropping and anti-scattering. Five different vibration modes can solve various oral problems.IPX7 waterproof function allows it to be cleaned in water in a short time without affecting performance. Equipped with 4 replacement original heads that you don't need to purchase them separately.Made of ABS material, it is very durable to use.The width of this product is 2.5cm and the height is 21cm.It is suitable for home, bathroom, adult and so on.Item Name: Electric ToothbrushMaterial: ABSPower: 1WCharging Time: 8 HoursWaterproof Rating: IPX7Battery Capacity: 500mAhCharging Input: DC5V-1AColor: Pink, Blue, White, BlackFeatures: Deep Cleaning, Stable Power, Anti-droppingFunction: Cleaning, Polishing, Brightening, Care, SensitiveSize Details: Size: 2.5cm x 21cm/1" x 8.3" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Five-speed Mode:Cleaning Mode:Brush your teeth for 2 minutes for better plaque removal, which is also the standard mode.Polishing Mode:Brush your teeth for 1 minute, and quickly polish and brighten your teeth for 1 minute.Bright White Mode:Brush your teeth for 2 minutes and 30 seconds, combined with a 2-minute cleaning mode, plus 30 seconds to brighten and polish the front teeth.Gum Health Care Mode:Brush your teeth for 3 minutes, combined with 2 minutes of cleaning mode, plus 1 minute of gentle stimulation and massage on the gums.Sensitive Mode:Brush your teeth for 2 minutes, aiming at the gentle brushing mode for sensitive teeth and gums or teeth in the sensitive period.Package Includes:1 x Electric Toothbrush4 x Brush Heads1 x USB CableKey FeaturesSuperb and professional workmanship makes this electric toothbrush anti-dropping and anti-scattering. Five different vibration modes can solve various oral problems.IPX7 waterproof function allows it to be cleaned in water in a short time without affecting performance. Equipped with 4 replacement original heads that you don't need to purchase them separately.Made of ABS material, it is very durable to use.The width of this product is 2.5cm and the height is 21cm.It is suitable for home, bathroom, adult and so on.What's In the Box1 x Electric Toothbrush4 x Brush Heads1 x USB Cable
IPX7 Waterproof Electric Toothbrush One-button Start-Pink
IPX7 Waterproof Electric Toothbrush One-button Start-Pink
₦ 28,152.91 ₦ 29,634.64 -5%
loader
Generic
Mini Vacuum Cleaner Computer Laptop Keyboard Dust-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions. Specifications: Inner cover for battery(not included), it is easy to replace battery. One-click start, convenient and quick to use. Super wind provides strong cleaning effect. Small and cute, light and portable, with 360 degree rising wind. Type: Keyboard Vacuum Cleaner Material: ABS, Electronic Components Rated Voltage: 15V Rated Power: 1.5W Frequency: 50HZ Features: Mini, Portable, Easy to Use, Dust Removal Size: 11cm x 8.5cm x 5.5cm/4.33" x 3.34" x 2.16" (Approx.) Notes: Due to the light and screen setting difference, the color of item may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement. Package Includes: 1 x Keyboard Vacuum CleanerKey FeaturesInner cover for battery(not included), it is easy to replace battery.One-click start, convenient and quick to use.Super wind provides strong cleaning effect.Small and cute, light and portable, with 360 degree rising wind.What's In the Box1 x Keyboard Vacuum Cleaner
Mini Vacuum Cleaner Computer Laptop Keyboard Dust-Pink
Mini Vacuum Cleaner Computer Laptop Keyboard Dust-Pink
₦ 31,140.76 ₦ 32,779.75 -5%
loader
Generic
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions. Specifications: Supercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise. Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue. Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving. It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass. This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc. Item Name: Desktop Vacuum Cleaner Material: Plastic Power Supply: Built-in 900mAh Battery (Included) Features: Multi-use, Mini, Desktop Cleaning, Capsule Shaped Size: 11cm x 6cm x 6cm/4.33" x 2.36" x 2.36" (Approx.) Notes: Due to the light and screen setting difference, the items color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement. Package Includes: 1 x Desktop Vacuum Cleaner 1 x USB CableKey FeaturesSupercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise.Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue.Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving.It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass.This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc.What's In the Box1 x Desktop Vacuum Cleaner1 x USB Cable
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Pink
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Pink
₦ 66,068.25 ₦ 69,545.53 -5%
loader
Generic
Electric Toothbrush Soft Brush Smart Timing IPX7-Red
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:This electric toothbrush has smart timing function, which can help your children develop scientific habit of brushing teeth. It has fully automatic wireless air-drying function, which is more convenient and sanitary to use.Featured with powerful motor and low-vibration sonic wave, the electric toothbrush can clean and whiten your children's teeth efficiently as well as protect their gums.Made of ABS and silicone, the electric toothbrush is eco-friendly, shock-proof and durable to use. It has 6 adjustable cleaning modes, which can meet your children's different using needs.The length of the electric toothbrush is 14cm, width is 9cm and height is 3cm. It features long standby time, which needs no frequent charging.The small size is suitable for 2-7 year-old children, the middle size is suitable for 8-15 year-old student, the large size is suitable for over 15 year-old adults.Item Name: Electric ToothbrushMaterial: Silicone,ABSStyle: S(for Children), M: (for Student), L(for Adult)(Optional)Waterproof Rating: IPX7Gear Position: Six Gear AdjustmentBrush Head Material: Food Grade SiliconeCharging Time:Key FeaturesThis electric toothbrush has smart timing function, which can help your children develop scientific habit of brushing teeth. It has fully automatic wireless air-drying function, which is more convenient and sanitary to use.Featured with powerful motor and low-vibration sonic wave, the electric toothbrush can clean and whiten your children's teeth efficiently as well as protect their gums.Made of ABS and silicone, the electric toothbrush is eco-friendly, shock-proof and durable to use. It has 6 adjustable cleaning modes, which can meet your children's different using needs.The length of the electric toothbrush is 14cm, width is 9cm and height is 3cm. It features long standby time, which needs no frequent charging.The small size is suitable for 2-7 year-old children, the middle size is suitable for 8-15 year-old student, the large size is suitable for over 15 year-old adults.
Electric Toothbrush Soft Brush Smart Timing IPX7-Red
Electric Toothbrush Soft Brush Smart Timing IPX7-Red
₦ 196,463.18 ₦ 206,803.35 -5%
loader
Generic
1 Set 450ml Soap Dispenser Automatic Sensor-Light Green
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Designed with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.Item Name: Soap DispenserMaterial: ABSCapacity: 450mlBattery: 14500 Lithium-ion BatteryNoise Reduction: 40DbCharging Interface: Type-CWaterproof: IPX 4Features: Automatic Sensor, Non-touching, Low ConsumptionSize Details: 10cm x 7.9cm x 21cm/3.94" x 3.11" x 8.27" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Soap Dispenser1 x Charging CableKey FeaturesDesigned with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.What's In the Box1 x Soap Dispenser1 x Charging Cable
1 Set 450ml Soap Dispenser Automatic Sensor-Light Green
1 Set 450ml Soap Dispenser Automatic Sensor-Light Green
₦ 92,767.19 ₦ 97,649.67 -5%
loader
Generic
3Pcs PVA Sponge Foam Rubber Mop Head Refill Replacement Home Floor Cleaning Pink (pink)
Specifications:Product name: Mop headMaterial: PVA sponge: Yellow, green, pink, greySize: Approx. 38x5.5cm/14.96inchx2.16inchQuantity: 3pcsWeight: 941gFeature:-100% new and high quality.-PVA foam rubber sponge mop head.-High density cotton head, super-absorbent, tenacious.-Absorbent, able to contain water, it can absorb several times more than its own weight of water.-Water washed away the , feel comfortable, dense material, summer mildew odor.-Will go up after the water washing, cotton mop head is too big plastic head itself, to avoid damage to furniture, there is full contact surface of the wall, a more thorough cleaning.-Caution:-Cotton pad will harden after evaporation of water to dry before use immersion in water to soften.-Simply wash cotton head repeatedly soaked in water and wrung out several times, the water temperature should be below 40 degrees.-To prolong the life, avoid direct sunlight.-Prolonged use cotton head pores are blocked, Always . a a a a a Key FeaturesMaterial: PVA spongeSize: Approx. 38x5.5cmQuantity: 3pcsWeight: 941gHigh density cotton headSuper-absorbentWater washed away the Feel comfortableEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box3x Mop heads
loader
Generic
3-in-1 Smart Sweeper Robot Automatic 1800PA Strong Suction Floor Cleaner Mop Black
Features: ●3 in 1 mode including sweeping, mopping vacuum ●Smart electrostatic cleaning The hair, dust and particles can be removed and cleaned efficiently ● Intelligent automatic sensing Encounter obstacles will change direction automatically. ●Low noise Low noise cleaning robot, working quietly will not affect your rest, work, etc. ● Easy operating pressing the button, it will automatic sweeping. ● Application for many kinds of environments Wooden floors, tiles, marble, etc. ● Work Normally on slope Can normally work on tile in about 20 degree ● Working mode Flexible move, with large dust garbage box. Specification: Material: ABS+Electronic Component Voltage: 7.4V Supply: direct charging Charging Type: Manual Charging Time: About 180min Working time: 100min : Black, White, Pink Size: 24.3*24.3*7cm Batte ry: 1500mAh batte ry Dirt may be blown out of the inlet, so please empty the dust box after each use. 1. The dust box is located at the bottom of the machine, pull the plug to turn outward. 2. Open the dust box, clean up the dirt inside, wipe out residuals using a dried damp cloth. 3. Place the dust box back into the machine. Warning: 1. For safety reasons, this product should be operated by people with physical and mental health and over 14 years of age. 2. This product is not waterproof, do not let the product contact any and shallow water, away from the source of . 3. It is forbidden to use in the suspended environment, such as rooftop, staircase, duplex house and so on. 4. When the product is at work, please take care of your family and pets to prevent falling, stampede and injuries. 5. The product uses universal design, when encountered in front of obstacles, the opportunity to change direction. 6. batteries with a supply of 6xAA Batteries must be installed with positive and negative prompts, but no installation errors. 7. Stop charging when the red light goes out, prevent overcharge, affect service life and accident. 8. If the product appears abnormal phenomena, such as odour, abnormal noise, excessive fever. Please stop using immediately. Note: There could be some slight differences in the tone of the pictures and the actual item. Please allow 1-2mm differs due to manual measurement, thanks. Package Included: 1 x Vacuum Cleaner Robot 1 x Charging Cable 1 x mop 1 x brush a a a a a Key FeaturesMaterial: ABS+Electronic ComponentVoltage: 7.4V Supply: direct chargingCharging Type: ManualCharging Time: About 180minWorking time: 100minSize: 24.3*24.3*7cmBatte ry: 1500mAh batte ryEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Vacuum Cleaner Robot 1 x Charging Cable 1 x mop 1 x brush
loader
Generic
30ml Portable Handheld Rechargeable Water Cold Spray-Blue
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:USB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.Item Name: Spray FanMaterial: ABSInput: 5V/1ABattery Capacity: 1200mAh (Included)Water Tank Capacity: 30mlAtomizing Particle: 0.3-0.7umFeatures: Rechargeable, Cooling Fan, , PortableBottom Diameter: 4cm/1.57" (Approx.)Height: 14.5cm/5.71" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Spray Fan1 x Charging CableKey FeaturesUSB charging, handheld and portable.2 in 1 design, this spray fan can give you coolness while hydrating your skin.Deeply and hydrating your skin, making you feel comfortable.Suitable for all skin types. A great gift for your friends, family or yourself.What's In the Box1 x Spray Fan1 x Charging Cable
30ml Portable Handheld Rechargeable Water Cold Spray-Blue
30ml Portable Handheld Rechargeable Water Cold Spray-Blue
₦ 33,185.92 ₦ 34,932.55 -5%
loader
Generic
Automatic Smart Robot Vacuum Cleaner Home-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:The robotic cleaner effectively picks up dirt, pet hair and dust from wooden floors, marble floors and nylon flooring.Capable of identify dangerous place such as desk, and turn direction automatically.Efficiently picking up hair, dust and dirt in all those annoying nooks and crannies under furniture.The cleaner robot runs automatically around home to adsorb the dust and dirt with the microfiber tissue.The microfiber tissue could be removed to clean.Easy operation, can not affected by blockage.Perfect for someone who doest like to sweep the house.Type: Cleaner RobotMaterial: ABSPower: 2.4WVoltage: 3VOccasions: Home, Office, Stores, etcFeatures: Automatic, Rechargeable, Robot Cleaner, Suction Sweeper, Home Cleaning ToolSize: 22.8cm x 22.8cm x 7cm/8.98" x 8.98 x 2.76" (Approx.) Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement. Package Includes:1 x Auto Cleaner Robot1 x USB CabelKey FeaturesThe robotic cleaner effectively picks up dirt, pet hair and dust from wooden floors, marble floors and nylon flooring.Capable of identify dangerous place such as desk, and turn direction automatically.Efficiently picking up hair, dust and dirt in all those annoying nooks and crannies under furniture.The cleaner robot runs automatically around home to adsorb the dust and dirt with the microfiber tissue.The microfiber tissue could be removed to clean.Easy operation, can not affected by blockage.Perfect for someone who doest like to sweep the house.What's In the Box1 x Auto Cleaner Robot1 x USB Cabel
Automatic Smart Robot Vacuum Cleaner Home-Black
Automatic Smart Robot Vacuum Cleaner Home-Black
₦ 118,379.61 ₦ 124,610.12 -5%
loader
Generic
1 Set 450ml Soap Dispenser Automatic Sensor Wide-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Designed with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.Item Name: Soap DispenserMaterial: ABSCapacity: 450mlBattery: 14500 Lithium-ion BatteryNoise Reduction: 40DbCharging Interface: Type-CWaterproof: IPX 4Features: Automatic Sensor, Non-touching, Low ConsumptionSize Details: 10cm x 7.9cm x 21cm/3.94" x 3.11" x 8.27" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Soap Dispenser1 x Charging CableKey FeaturesDesigned with the type-c interface, this dispenser is very easy for you to recharge, and it can last 45 day for each charging, and it has a smart sensor device which can automatically dispense soap without touching.What this dispenser can offer you is that can be used as a wonderful gift for your families, friends and colleagues, because it is very high-efficiency and low consumption with the simple style appearance.Made of ABS, it is lightweight and durable to use.The length of this dispenser is 10cm, the width is 7.9cm and the height is 21cm.It is suitable for bathroom, kitchen, toilet and so on.What's In the Box1 x Soap Dispenser1 x Charging Cable
1 Set 450ml Soap Dispenser Automatic Sensor Wide-White
1 Set 450ml Soap Dispenser Automatic Sensor Wide-White
₦ 92,000.25 ₦ 96,842.37 -5%
loader
Generic
Sweeping Robot Ultra-thin 360 Degrees High Speed-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:This product has a strong suction and v-style bristles, which can picks up dust, crumbs and dirt quickly and efficiently.This product adopts sealed dust box and low noise design, which can hold a lot of dust and would not disturb you when working.Sweeping robot is made of high quality ABS material, lightweight and durable. This product built in 1200mah large battery, fully charged can work about 90 minutes. 360 degrees smart sensor cleaning robot can accurately dodge obstacles and anti-drop.Sweeping machine length is 32cm, width is 32cm and hight is 7cm.This product is suitable for daily cleaning of home and office.Item Name: Sweeping RobotMaterial:ABSBatteries: 1200mahRated Voltage: 3.7VSize:32cmx32cmx7cm/12.6inx12.6inx2.76inNotes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement.Package Includes:1 X Sweeping Robot1 X Power Cable1 X User Manual2 X Brushes1 X Cleaning ClothKey FeaturesThis product has a strong suction and v-style bristles, which can picks up dust, crumbs and dirt quickly and efficiently.This product adopts sealed dust box and low noise design, which can hold a lot of dust and would not disturb you when working.Sweeping robot is made of high quality ABS material, lightweight and durable. This product built in 1200mah large battery, fully charged can work about 90 minutes. 360 degrees smart sensor cleaning robot can accurately dodge obstacles and anti-drop.Sweeping machine length is 32cm, width is 32cm and hight is 7cm.This product is suitable for daily cleaning of home and office.What's In the Box1 X Sweeping Robot1 X Power Cable1 X User Manual2 X Brushes1 X Cleaning Cloth
Sweeping Robot Ultra-thin 360 Degrees High Speed-Pink
Sweeping Robot Ultra-thin 360 Degrees High Speed-Pink
₦ 193,523.27 ₦ 203,708.70 -5%
loader
Generic
Automatic Smart Cleaning Robot Dust Sweeper Vacuum Cleaner Auto Machine Cleaner -- Back / White White
Features: - This Vacuum Cleaner Robot is made of high quality ABS material, durable and not-faded. - Equipped with dust garbage room. Big dust box with double filters. - Automatically move and clean the floor. - The walls and obstacles will change direction immediately. - Flexible obstacle avoidance. Efficient clean. - Low noise and high efficiency. - Ultra-thin body, 65mm thick. The main body is thicker than the industry average, it can easily get through the bottom of sofa, bed and low places. Specification: Name: Vacuum Cleaner Robot Model: 2830 Size: 18*18*7CM Material:ABS + Electronic Components Charging time: about 60 minutes consumption time: about 60 minutes Built-in : 18650 capacity: 1800mA Voltage: 3.7V Speed:1500 rpm Product accessories: 1 X Vacuum Cleaner Robot, 1 X Charging line, 2 X Brush, 1 X Instructions Please Notes: 1.Please allow slight dimension difference due to different manual measurement. 2.Due to the different and light effect, the actual of the item might be slightly different from the showed on the pictures. Thank you! a a a a a Key Features: Back / WhiteSize: 18*18*7CMMaterial: ABS + Electronic ComponentsBuilt-in : 18650 consumption time: about 60 minutes capacity: 1800mALow noise and high efficiency and high qualityEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 X Vacuum Cleaner Robot, 1 X Charging line, 2 X Brush, 1 X Instructions
loader
Generic
Electric Toothbrush Cartoon Shape Soft Bristles IPX7-Blue
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Cartoon style can successfully attract children's attention and make them love brushing teeth. And this electric toothbrush features IPX7 waterproof, it is safe to use.With ultra soft bristles, the electric toothbrush for kids won't hurt the delicate enamel of milk teeth, perfect for baby's gums and small mouth.Made of high quality ABS material, kid electric toothbrush is very durable to use.The length of kid electric toothbrush is 19.8cm, width is 3.2cm, height is 3.2cm.It is suitable for home, bathroom, travel, kids and so on.Item Name: Children Electric ToothbrushMaterial: Rubber,ABSApplicable Age: for 3-12 Years Old Battery: 1 x 1.5V AA Battery (Included)Power Mode: ElectricControl Method: Push-buttonElectric Toothbrush Type: Sonic Features: Soft Fur, Cartoon Shape, DurableSize Details: Size: 19.8cm x 3.2cm x 3.2cm/7.8" x 1.26" x 1.26" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Electric ToothbrushKey FeaturesCartoon style can successfully attract children's attention and make them love brushing teeth. And this electric toothbrush features IPX7 waterproof, it is safe to use.With ultra soft bristles, the electric toothbrush for kids won't hurt the delicate enamel of milk teeth, perfect for baby's gums and small mouth.Made of high quality ABS material, kid electric toothbrush is very durable to use.The length of kid electric toothbrush is 19.8cm, width is 3.2cm, height is 3.2cm.It is suitable for home, bathroom, travel, kids and so on.What's In the Box1 x Electric Toothbrush
Electric Toothbrush Cartoon Shape Soft Bristles IPX7-Blue
Electric Toothbrush Cartoon Shape Soft Bristles IPX7-Blue
₦ 17,991.02 ₦ 18,937.92 -5%
loader
Generic
Soft Bristles Sonic Electric Toothbrush IPX5-Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:With removable brush heads, it is convenient for you to replace and use.Ultra soft bristles of sonic electric toothbrush for kids do not hurt the delicate enamel of milk teeth, perfect for baby's gums and small mouth.Cute rabbit shape is perfectly designed to make brushing easy and fun for little kids. 30,000 Sonic stroke vibrations per minute gives your child teeth the best possible clean in 3 the time of other kids toothbrushes. This kids electric toothbrush has comfortable and anti-slip handle, which is designed for small little hands.Made of high quality ABS material, kid electric toothbrush is very durable to use.The length of kid electric toothbrush is 15.5cm, the width of kid electric toothbrush is 2.5cm.It is suitable for home, bathroom, travel, kids and so on.Item Name: Electric ToothbrushMaterial: ABSInput Voltage: 1.5VBattery: 1 x 1.5V AAA Battery (Included)Product Color: Pink, BlueApplicable Age: for 3-15 Years Old KidsToothbrush Vibration Frequency: 30000 Times/MinuteFeatures: Removable Brush Heads, Soft Bristles, Rabbit ShapeSize Details: Size: 15.5cm x 2.5cm/6.11" x 0.99" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Electric Toothbrush1 x BatteryKey FeaturesWith removable brush heads, it is convenient for you to replace and use.Ultra soft bristles of sonic electric toothbrush for kids do not hurt the delicate enamel of milk teeth, perfect for baby's gums and small mouth.Cute rabbit shape is perfectly designed to make brushing easy and fun for little kids. 30,000 Sonic stroke vibrations per minute gives your child teeth the best possible clean in 3 the time of other kids toothbrushes. This kids electric toothbrush has comfortable and anti-slip handle, which is designed for small little hands.Made of high quality ABS material, kid electric toothbrush is very durable to use.The length of kid electric toothbrush is 15.5cm, the width of kid electric toothbrush is 2.5cm.It is suitable for home, bathroom, travel, kids and so on.What's In the Box1 x Electric Toothbrush1 x Battery
Soft Bristles Sonic Electric Toothbrush IPX5-Pink
Soft Bristles Sonic Electric Toothbrush IPX5-Pink
₦ 18,454.37 ₦ 19,425.65 -5%
loader
Generic
ES250 Rechargeable Automatic Smart Robot 1800Pa-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:It can automatically change directions when encountering obstacles.With the built-in large-capacity battery, it can be used repeatedly when fully charged.The cleaner robot can clean underneath furniture, sofas and other areas that are hard to reach, creating a clean and comfortable home.Item Name: Smart CleanerMaterial: ABS, MetalOperation Method: MechanicalPower Supply: USBTiming Function: NoRated Voltage: 3.7VSwitch Type: Common ButtonCleaning Route: RandomService Environment: HouseholdRemote Control: NoLCD Display: NoCleaning Method: Sweeping & Vacuuming & Mopping, 3 in 1Battery: 3.7V/1500mAh (Included)Working Time: about 100 MinutesCharging Time: 1.5hSuction: 1800PaCleaning Area: 150 Square MetersRated Power: 5WWorking Voltage: 3.7VFeatures: Rechargeable, Automatic, Mute, Easy to UseSize: Diameter: 25cm/9.84", Thickness: 7cm/2.76" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Smart Cleaner1 x Charging Cable1 x Cleaning Towel2 x Brushes1 x User ManualKey FeaturesIt can automatically change directions when encountering obstacles.With the built-in large-capacity battery, it can be used repeatedly when fully charged.The cleaner robot can clean underneath furniture, sofas and other areas that are hard to reach, creating a clean and comfortable home.What's In the Box1 x Smart Cleaner1 x Charging Cable1 x Cleaning Towel2 x Brushes1 x User Manual
ES250 Rechargeable Automatic Smart Robot 1800Pa-White
ES250 Rechargeable Automatic Smart Robot 1800Pa-White
₦ 137,664.83 ₦ 144,910.35 -5%
loader
Generic
Electric Toothbrush Soft Brush Smart Timing IPX7-Hot Pink
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:This electric toothbrush has smart timing function, which can help your children develop scientific habit of brushing teeth. It has fully automatic wireless air-drying function, which is more convenient and sanitary to use.Featured with powerful motor and low-vibration sonic wave, the electric toothbrush can clean and whiten your children's teeth efficiently as well as protect their gums.Made of ABS and silicone, the electric toothbrush is eco-friendly, shock-proof and durable to use. It has 6 adjustable cleaning modes, which can meet your children's different using needs.The length of the electric toothbrush is 14cm, width is 9cm and height is 3cm. It features long standby time, which needs no frequent charging.The small size is suitable for 2-7 year-old children, the middle size is suitable for 8-15 year-old student, the large size is suitable for over 15 year-old adults.Item Name: Electric ToothbrushMaterial: Silicone,ABSStyle: S(for Children), M: (for Student), L(for Adult)(Optional)Waterproof Rating: IPX7Gear Position: Six Gear AdjustmentBrush Head Material: Food Grade SiliconeCharging Time:Key FeaturesThis electric toothbrush has smart timing function, which can help your children develop scientific habit of brushing teeth. It has fully automatic wireless air-drying function, which is more convenient and sanitary to use.Featured with powerful motor and low-vibration sonic wave, the electric toothbrush can clean and whiten your children's teeth efficiently as well as protect their gums.Made of ABS and silicone, the electric toothbrush is eco-friendly, shock-proof and durable to use. It has 6 adjustable cleaning modes, which can meet your children's different using needs.The length of the electric toothbrush is 14cm, width is 9cm and height is 3cm. It features long standby time, which needs no frequent charging.The small size is suitable for 2-7 year-old children, the middle size is suitable for 8-15 year-old student, the large size is suitable for over 15 year-old adults.
Electric Toothbrush Soft Brush Smart Timing IPX7-Hot  Pink
Electric Toothbrush Soft Brush Smart Timing IPX7-Hot Pink
₦ 196,463.18 ₦ 206,803.35 -5%
loader
Generic
Sweeping Robot Strong Suction Low Noise ABS Automatic-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:This product comes with 4cm ultra-thin and compact body design, which can cleaning every corner of your room.This product is equipped with a detachable sealed dust box, which is easy to clean and hold garbage. 55 dB low noise design, using this product would not disturb your normal work.Sweeping robot is made of high quality ABS material, lightweight and durable. This product built in 2400mah large battery, fully charged can work about 85 minutes. This product can accurately dodge obstacles, so you have no need to worry about damage.Vacuum robot length is 27.8cm, width is 27.8cm and height is 6.8 cm.This product is suitable for daily cleaning of home and office.Item Name: Sweeping RobotMaterial:ABSBatteries: 2400mahRated Voltage: 3.7VSize:27.8cmx27.8cmx6.8cm/10.94inx10.94inx2.68inNotes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement.Package Includes:1 X Cleaning Cloth1 X Brush1 X Power Cable1 X User Manual1 X Sweeping RobotKey FeaturesThis product comes with 4cm ultra-thin and compact body design, which can cleaning every corner of your room.This product is equipped with a detachable sealed dust box, which is easy to clean and hold garbage. 55 dB low noise design, using this product would not disturb your normal work.Sweeping robot is made of high quality ABS material, lightweight and durable. This product built in 2400mah large battery, fully charged can work about 85 minutes. This product can accurately dodge obstacles, so you have no need to worry about damage.Vacuum robot length is 27.8cm, width is 27.8cm and height is 6.8 cm.This product is suitable for daily cleaning of home and office.What's In the Box1 X Cleaning Cloth1 X Brush1 X Power Cable1 X User Manual1 X Sweeping Robot
Sweeping Robot Strong Suction Low Noise ABS Automatic-White
Sweeping Robot Strong Suction Low Noise ABS Automatic-White
₦ 154,713.15 ₦ 162,855.95 -5%
loader
Generic
Wall-mounted/Floor-standing Bathroom Cleaning Supplies Creative Toilet Brushes Sets Stainless Steel Brush For Hotel And Home Toilet Antique White
Bathroom Cleaning Supplies Creative Toilet Brushes Sets Handle Right Corner Brush Stainless Steel Toilet Cleaning Scraper Antique White floor-standing Apricot wall-mounted [Note: is the choose of the model, not real ; just means the meaning of the model] Features: -100% New and High Quality!!! -PVR environmentally friendly plastic, -Odorless and safe, decontamination and strong -No damage to the surface, specializing in all kinds of dead ends. -Stainless steel grip, anti-shedding, clean and effortless -360° thick brush head, strong adsorption, effective decontamination -Hanging drain base:Internal hollow suspension design, water can be evaporated by the upper and lower ends, no water, no dirty -Rounded corners, no burrs:Frosted surface, thick material, tight fit between components Specifications: :White+Black Size: Brush total length: 31cm*10.5cm*10.5cm/12.20*4.13*4.13inch Material: Stainless steel + ABS Style: wall-mounted, floor-standing (optional) Packagedincluded: 1 x toilet brush Please pay attention when installing the wall-mounted models: [1] The wall is flat and sturdy. Such as tiles, glass, wooden walls and so on. It can not be used for uneven walls that are not smooth, such as stucco walls, paint walls, and wallpapers. [2] After pressing the wall, please press hard to drain the air in the patch, and do not have small bubbles. Note: 1.Pleaseallow0.5-1cmdifferencesduetomanualmeasurement. 2.Duetothelightandscreendifference,theitem'scolormaybeslightlydifferentfromthepictures. a a a a a Key Features-PVR environmentally friendly plastic,-Odorless and safe, decontamination and strong-No damage to the surface-Stainless steel grip-360° thick brush head-Hanging drain base-Rounded cornersEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x toilet brush
loader
Generic
1 Set Household Vacuum Cleaner Wireless Handheld-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:You can use this vacuum cleaner for deep cleaning, giving you a cleaner living space and effectively preventing secondary pollution because of its three-layer filtration process.Featuring high-frequency vibration, this vacuum cleaner cleans while avoiding wrinkles in the sheets, and its handheld design makes it easy to grip and hold.Constructed of abs material, the vacuum cleaner is lightweight.The length of this vacuum cleaner is 20cm, the width is 12cm.It is suitable for home, bed, bed sheet, bedroom, indoor and so on. Please note that the filter element is not washable.Item Name: Bed Vacuum CleanerMaterial: ABSBattery Capacity: 1200mAhDust Cup Capacity: About 0.2LFeatures: Large Power, Deep Cleaning, Multi-layer FiltrationSize Details:20cm x 12cm/7.87" x 4.72" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Charging Cable1 x Bed Vacuum CleanerKey FeaturesYou can use this vacuum cleaner for deep cleaning, giving you a cleaner living space and effectively preventing secondary pollution because of its three-layer filtration process.Featuring high-frequency vibration, this vacuum cleaner cleans while avoiding wrinkles in the sheets, and its handheld design makes it easy to grip and hold.Constructed of abs material, the vacuum cleaner is lightweight.The length of this vacuum cleaner is 20cm, the width is 12cm.It is suitable for home, bed, bed sheet, bedroom, indoor and so on. Please note that the filter element is not washable.What's In the Box1 x Charging Cable1 x Bed Vacuum Cleaner
1 Set Household Vacuum Cleaner Wireless Handheld-White
1 Set Household Vacuum Cleaner Wireless Handheld-White
₦ 100,021.10 ₦ 105,285.37 -5%
loader
Generic
ES32 Home Automatic 1800Pa Smart Robot Vacuum Cleaner-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:The smart cleaner can automatically move and clean the floor.It also can automatically change direction when it encounters walls and other obstacles.It is a low-noise cleaning robot, which works quietly and will not affect your rest and work.This smart robot is suitable for the ground: marble, tile, wooden floor, etc..Item Name: Smart CleanerMaterial: ABS, MetalOperation Method: MechanicalPower Supply: USBTiming Function: NoRated Voltage: 3.7VSwitch Type: Common ButtonCleaning Route: RandomService Environment: HouseholdRemote Control: NoLCD Display: NoCleaning Method: Sweeping & Vacuuming & Mopping, 3 in 1Battery: 3.7V/1500mAh (Included)Working Time: about 100 MinutesCharging Time: 1.5hSuction: 1800PaCleaning Area: 150 Square MetersRated Power: 5WWorking Voltage: 3.7VFeatures: Smart, Rechargeable, Auto Cleaning, Low NoiseSize: 30.5cm x 30.5cm x 6.8cm/12" x 12" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Smart Cleaner1 x Charging Cable1 x Cleaning Towel2 x Hair Brushes1 x Cleaning Brush1 x User ManualKey FeaturesThe smart cleaner can automatically move and clean the floor.It also can automatically change direction when it encounters walls and other obstacles.It is a low-noise cleaning robot, which works quietly and will not affect your rest and work.This smart robot is suitable for the ground: marble, tile, wooden floor, etc..What's In the Box1 x Smart Cleaner1 x Charging Cable1 x Cleaning Towel2 x Hair Brushes1 x Cleaning Brush1 x User Manual
ES32 Home Automatic 1800Pa Smart Robot Vacuum Cleaner-White
ES32 Home Automatic 1800Pa Smart Robot Vacuum Cleaner-White
₦ 230,847.44 ₦ 242,997.30 -5%
loader
Generic
Waterproof Washing Machine Zippered Top Dust Cover Protection Top /Front Cover Deer White
Package Include: 1 x Washing Machine Cover Features: 1.Beautiful and comfortable 2.PEVA production, cold, lightweight, and comfortable, the three layer thicker more durable. 3.Dustproof, moisture-proof, mouldproof 4.The washing machine guard will protect your washing machine from dust and any mold. 5.It is able to protect the washing machine and will reduce the affection caused by the dampness. 6.Give your laundry room a makeover and add some . 7.Suitable for automatic Washing Machine and drum Washing Machine Specification: 1.Size:60*56*83 cm 2.Material: PEVA 3.Pattern: Deer Notice 1、Please allow 1-3cm error due to manual measurement. Pls make sure you do not mind before you bid. 2、The may have different as the difference display, pls understand. a a a a a Key FeaturesPattern: DeerMaterial: PEVA: WhiteSize:60*56*83 cmBeautiful and comfortable and high qualityEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Washing Machine Cover
loader
Generic
Kitchen 3-IN-1 Sponge Rag Holder Rack Drain Tray Stainless Steel Organizer Hold Rag Rack Types A/B Black Black Type A
Kitchen 3-IN-1 Sponge Rag Holder Rack Drain Tray Stainless Steel Organizer Hold Rag Rack Types A/B Black a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1x Kitchen Rack 1x Drain Tray 1x Adhesive Back Hook
loader
Generic
I262 300x130mm Rag For ILIFE S
I262 300x130mm Rag for ILIFE S1. Type: Vacuum cleaner parts2. Compatible models: Item for ILIFE V7S V7S PRO Series.3. Easy to remove and replace as part of routine maintenance.4. Replacement rag for ILIFE Professional Series robots.5. For best results, the filter should be replaced every 2-3 months.Key FeaturesI262 300x130mm Rag for ILIFE SI262 300x130mm Rag for ILIFE SI262 300x130mm Rag for ILIFE SI262 300x130mm Rag for ILIFE SI262 300x130mm Rag for ILIFE SWhat's In the Box1 x package
I262 300x130mm Rag For ILIFE S
I262 300x130mm Rag For ILIFE S
₦ 6,550.91 ₦ 6,895.69 -5%

Featured Products

View All

Top Stores : Brand Directory