×

Download App Today & Register Now

Get Flat ₦100 on your RM Wallet*

Buy Headboards Products online in Nigeria

Filter By

Headboards Products

icon_filter
Filters
loader
915 Generation
3 Pcs Coffee Milk Tea Dispenser Syrup Pump Black Liquid
Detailed Information About The Product:Function: very suitable for individuals and professionals to add your drinks, food and cooking exploration.Exquisite design: The exquisite design has a fixed angle to ensure that every single time use.Quantitative: each press can press 8ml.Great for adding syrup to coffees, tea, sodas, smoothies, cocktails, milkshakes and more.High quality syrup pumps.Model Number: Pumpcolour:GoldMaterial:plasticPackage Contents:3 x Pump headOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.18097. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityFunction: very suitable for individuals and professionals to add your drinks, food and cooking exploration.Exquisite design: The exquisite design has a fixed angle to ensure that every single time use.Quantitative: each press can press 8ml.Great for adding syrup to coffees, tea, sodas, smoothies, cocktails, milkshakes and more.High quality syrup pumps.The details are as described aboveWhat's In the Box3 x Pump head
3 Pcs Coffee Milk Tea Dispenser Syrup Pump Black Liquid
3 Pcs Coffee Milk Tea Dispenser Syrup Pump Black Liquid
₦ 13,788.85 ₦ 14,514.58 -5%
loader
915 Generation
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
Detailed Information About The Product:Universal Brush Carpet Seat Washing ApparatusSeat and carpet washing water absorbent vacuum head universal compatibleIt is used to absorb water after seat and carpet washing.Shows the absorption of water through the transparent phone.100% as description and high qualitySelected materials, long-term use will not be damaged, fine workmanship.Vacuum Part Type: BrushesType: Vacuum Cleaner PartsFor Universal 38mm Wet/Dry Vacuum Cleaner Water Nozzlesize:The inner diameter 38mmSteel pipe: 21cmMaterial:Plastic + Metalcolour:Silver + TransparentPackage Contents:1 * Steel pipe1 * Big Brush Head(192x190mm)1 * Small Brush Head(150x93mm)Only the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have anyKey FeaturesDurable and good qualityVacuum Floor NozzleCarpet Cleaner HeadVacuum Cleaner Brush HeadVacuum Cleaner PartsUniversal Vacuum NozzleThe details are as described aboveWhat's In the Box1 * Steel pipe1 * Big Brush Head(192x190mm)1 * Small Brush Head(150x93mm)
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
₦ 62,920.63 ₦ 66,232.24 -5%
loader
Generic
60 Plasma Cutter Accessories,Cutting Torch Electrode for Ag6
Detailed Information About The Product:Nozzles and electrodes are made of high quality copper material.You can replace the broken one during the cutting process and easily complete the cutting process.Nozzles are considered plasma cutter consumables, they are essential for the plasma cutting project.Easy to change: Many nozzles and electrodes are spares, convenient to replace the broken ones during the cutting process, the cutting project runs smoothly.Professional Accessories: Nozzle considered as a plasma cutter consumable, they are essential for the plasma cutting project Made of high-quality material, durable and practical to use.Category: Plasma Cutting Machine Type: Consumables Kit for Plasma Cutting MachinesSuitable for -60 SG-55 WSD-60 plasma accessoriesSpecifications:Colour: silverMaterial: copper stainless steelSize: protective cap: 2X1CMItem type: plasma cutter air compressor Package Contents:10 x insulation ring.10 x protective caps.40 x fine electrode.40 x nozzles Only the above package content, other are not included.Note: Light and different displays may cause the color of the item in the a little different from the real . The measurement allowed error is /- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customers. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please dont be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key FeaturesDurable and good qualityplasmaplasmaschneider plasmaschneider plasmaschneiderplasma cutterThe details are as described aboveWhat's In the Box10 x insulation ring.10 x protective caps.40 x fine electrode.40 x nozzles
60 Plasma Cutter Accessories,Cutting Torch Electrode for Ag6
60 Plasma Cutter Accessories,Cutting Torch Electrode for Ag6
₦ 194,689.65 ₦ 204,936.47 -5%
loader
Generic
High Pressure Shower Heads Set, Detachable
[HIGH PRESSURE]Discover the Ultimate Combination of Premium Quality, High Power, Latest Design Protection Powerful and multi-Functional Handheld Showerhead kit , Creates a Pressure-Increasing Stream and Delivers Water at a Higher Velocity to Compensate for Low Water Pressure Situations.[ANGLE-ADJUSTABLE OVERHEAD BRACKET]Durable and Chrome Plated Durable Material Angle Adjustable Holder Never Breaks, Allowing You to Adjust the Showerhead for the Best Angle. Solid Metal Hose Nuts, Filter and Washer Insure Rliable Leak-proof Connection.[MULTIPLE MODE ADJUSTABLE SETTINGS]Shower Head Has Multiple Different Spray Patterns: Power Massage,Rainfall Shower, Waterfall Mist, One-press Water Stop, Multiple Different Spray Style Provides You a Pleasant Shower Experience ! Make Your Showering Memorable in Powerful and Impressed ![STAINLESS STEEL HOSE & SHOWER HEAD HOLDER]Chrome Plated Durable Material Offer superior flexible and longer reach hose than other hand showers. It is also perfect for Bathing Kids, Washing Pets and Cleaning applications. 1/2 inch connector fits with any universal shower arm.[EASY INSTALLATION]No Need to Call a Plumber - Simply Remove Your Current Shower Head.No need to Ask for Help! Installs in Minutes With Just One Hand-tightened Connection.Colour:silverMaterial:plasticPackage Contents:1 * shower1 * connecting pipe1 * base1 * uncooked tapeOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.27191. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Featuresdetachable shower headhigh pressure shower headshandheld shower headsshower head with hoseshowerhead
High Pressure Shower Heads Set, Detachable
High Pressure Shower Heads Set, Detachable
₦ 46,447.50 ₦ 48,892.10 -5%
loader
915 Generation
5D Electric s Repment Heads s Heads
Detailed Information About The Product:1.Repment Head: You can rep old or broken heads to give the product a new look. Its 5d flex floating heads rotate to follow the contours of your face, head, neck and jaw, offering closer and cleaner trimming without skin irritation.2.5D Shaving Repment: The repment adopts a design of 5- nets to further increase the contact area with your skin. Increase the contact area, built-in sharp , efficient and convenient shaving, reduce back scratches.3.Automatic Grinding Head: During the use of the electric , the net and the rub against each other to realize the automatic head grinding function, which makes the electric sharper and brings you a comfortable and efficient shaving experience.4.Waterproof Head: The head for men allows you to clean after shaving. You can open the head and clean the inside, which can reduce the residual beard residue in the s head and extend the service life of the head.5.Universal Head : Universal repment heads for all 5 head s. As long as it is the same as the head repment interface of an electric , it can be repd.Colour:GoldMaterial:Plastic + MetalPackage Contents:1 x headsOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good quality Headss Repment HeadsBald Head s Heads5D Electric s Heads Head For MenThe details are as described aboveWhat's In the Box1 x Shaver blade heads
5D Electric s Repment Heads  s Heads
5D Electric s Repment Heads s Heads
₦ 19,125.45 ₦ 20,132.05 -5%
loader
Generic
7D Electric Replacement Heads 7 Heads Head Color)
Detailed Information About The Product:1. 7 blade heads, 7D larger contact surface, faster shaving,bring you faster and cleaner shaving process. Easy to use, just snap on and shave Washable, easy to clean.2.Men's Electric Replacement Heads, men's electric shavers features electroplate surfaces for anti-abrasion, double-ring hypoallergenic stainless blades and a powerful motor. 6d flex floating heads rotate to the of your , head, neck and , offering closer and cleaner trimming without irritation.3. -Sharpening Technology The with -sharpening technology will not yank out your beard during shaving.4. Replacement Heads :Can replace the or broken head , let the product look new and reuse, Save money.continue to accompany the to keep it working and continue to realize function.same as bayonet, can be used)5.Waterproof Head: The head blade for men allows you to clean after shaving. You can open the head and clean the inside, which can reduce the residual beard residue in the razors head and extend the service life of the head. Colour: colorMaterial:Plastic Metal Package Contents:1 x blade heads Only the above package content, other are not included.Note: Light and different displays may cause the color of the item in the a little different from the real . The measurement allowed error is /- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customers. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please dont be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key FeaturesDurable and good quality Blade Heads Replacement Heads7 Heads HeadsBald Beard Head For MenThe details are as described aboveWhat's In the Box1 x Shaver blade heads
7D Electric Replacement Heads 7 Heads Head  Color)
7D Electric Replacement Heads 7 Heads Head Color)
₦ 28,552.35 ₦ 30,055.10 -5%
loader
Generic
9 Settings High Pressure Handheld Shower Head, Easy to
Detailed Information About The Product:High Pressure: Handheld shower head creates a pressure-increasing stream to give you powerful water flow even if you typically experience low water pressure. Help you relieve fatigue and relax muscles.Multi-functional Settings: 9 spray settings include pause mode to help you reduces flow to a trickle instead off complete shutoff. This prevents the buildup of water pressure and hot temperature to protect you from scalding.Advanced Material: High-quality ABS plastic body polished chrome makes it sturdy, drop resistant, durable and lightweight, not easy to damaged when dropping from height.Self-Cleaning Jet Nozzles: With touch to clean nozzles prevent lime scale build up and remove hard water deposits for easy maintenance, resistant to clogging.Easy Installation: No plumber and tools need, installs in minutes. Fits any standard shower arm. With upgraded package which includes 59inch flexible stainless steel shower hose, angle-adjustable bracket, PTFE tape and washers.Colour: silverMaterial: ABSPackage Contents:1 x Hand shower1 x 1.5m hose1 x Bracket1 x Raw material beltOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.23312. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityHigh Pressure: Handheld shower head creates a pressure-increasing stream to give you powerful water flow even if you typically experience low water pressure. Help you relieve fatigue and relax muscles.Multi-functional Settings: 9 spray settings include pause mode to help you reduces flow to a trickle instead off complete shutoff. This prevents the buildup of water pressure and hot temperature to protect you from scalding.Advanced Material: High-quality ABS plastic body polished chrome makes it sturdy, drop resistant, durable and lightweight, not easy to damaged when dropping from height.Self-Cleaning Jet Nozzles: With touch to clean nozzles prevent lime scale build up and remove hard water deposits for easy maintenance, resistant to clogging.Easy Installation: No plumber and tools need, installs in minutes. Fits any standard shower arm. With upgraded package which includes 59inch flexible stainless steel shower hose, angle-adjustable bracket, PTFE tape and washers.The details are as described aboveWhat's In the Box1 x Hand shower1 x 1.5m hose1 x Bracket1 x Raw material belt
9 Settings High Pressure Handheld Shower Head, Easy to
9 Settings High Pressure Handheld Shower Head, Easy to
₦ 75,686.90 ₦ 79,670.42 -5%
loader
915 Generation
Light Blue Hydrangea Silk Flowers Heads Pack of 20 Full
Detailed Information About The Product:1. Size: Hydrangea heads are approx. 7 inches in diameter ,the stems are 7.5 inches long, the hydrangea flowers are full and beautiful, 54 petals in each bloom,2. Material: Made of high quality silk cloth and plastic, the long stems are made of plastic with iron wire inside, it can be cutted shorter easily to meet your DIY projects.3. Advantage:Can be reused over and over again, each color is vivid to make your event special!4. Multi-use:Perfect for wedding,festivals, parties,DIY bouquets,home decor,shop,table centerpieces,wedding arrangements,bride bouquets,bridal shower, baby shower, wreath and other decoration.Specification:Colour:light blueMaterial:Silk cloth + plasticPackage Contents:20 * full silk hydrangea heads20 * leaf20 * long stemsOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have anyKey FeaturesDurable and good qualitySilk Flowers HeadsSilk FlowersArtificial Flower HeadsSilk Hydrangea HeadsArtificial FlowerThe details are as described aboveWhat's In the Box20 * full silk hydrangea heads20 * leaf20 * long stems
Light Blue Hydrangea Silk Flowers Heads Pack of 20 Full
Light Blue Hydrangea Silk Flowers Heads Pack of 20 Full
₦ 40,439.84 ₦ 42,568.25 -5%
loader
Generic
Shower Head, 5 Settings Showerhead with Adjustable Swivel
Detailed Information About The Product:5-Setting: Rain Mode, Massage Mode, Mixed Mode, Pulse Mode, Spray Mode. Five shower modes can make you and your family enjoy natural comfortable shower at home.Excellent Construction: Our shower heads are built to the highest quality plastic and the latest fine-spray chrome technology for durability. It has an adjustable angled brass ball joint that you can adjust for any shower angle what you want.Easy Installation: Our shower head use a standard G1/2 interface and you can install it without any tools (we will provide PTFE tape for you).Colour: silverMaterial: ABSPackage Contents:1 * Shower headOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.23310. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good quality5-Setting: Rain Mode, Massage Mode, Mixed Mode, Pulse Mode, Spray Mode. Five shower modes can make you and your family enjoy natural comfortable shower at home.Excellent Construction: Our shower heads are built to the highest quality plastic and the latest fine-spray chrome technology for durability. It has an adjustable angled brass ball joint that you can adjust for any shower angle what you want.Easy Installation: Our shower head use a standard G1/2 interface and you can install it without any tools (we will provide PTFE tape for you).The details are as described aboveWhat's In the Box1 * Shower head
Shower Head, 5 Settings Showerhead with Adjustable Swivel
Shower Head, 5 Settings Showerhead with Adjustable Swivel
₦ 30,853.15 ₦ 32,477.00 -5%
loader
915 Generation
9 Settings High Pressure Handheld Shower Head, Easy to
Detailed Information About The Product:High Pressure: Handheld shower head creates a pressure-increasing stream to give you powerful water flow even if you typically experience low water pressure. Help you relieve fatigue and relax muscles.Multi-functional Settings: 9 spray settings include pause mode to help you reduces flow to a trickle instead off complete shutoff. This prevents the buildup of water pressure and hot temperature to protect you from scalding.Advanced Material: High-quality ABS plastic body polished chrome makes it sturdy, drop resistant, durable and lightweight, not easy to damaged when dropping from height.Self-Cleaning Jet Nozzles: With touch to clean nozzles prevent lime scale build up and remove hard water deposits for easy maintenance, resistant to clogging.Easy Installation: No plumber and tools need, installs in minutes. Fits any standard shower arm. With upgraded package which includes 59inch flexible stainless steel shower hose, angle-adjustable bracket, PTFE tape and washers.Colour: silverMaterial: ABSPackage Contents:1 x Hand shower1 x 1.5m hose1 x Bracket1 x Raw material beltOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.23312. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityHigh Pressure: Handheld shower head creates a pressure-increasing stream to give you powerful water flow even if you typically experience low water pressure. Help you relieve fatigue and relax muscles.Multi-functional Settings: 9 spray settings include pause mode to help you reduces flow to a trickle instead off complete shutoff. This prevents the buildup of water pressure and hot temperature to protect you from scalding.Advanced Material: High-quality ABS plastic body polished chrome makes it sturdy, drop resistant, durable and lightweight, not easy to damaged when dropping from height.Self-Cleaning Jet Nozzles: With touch to clean nozzles prevent lime scale build up and remove hard water deposits for easy maintenance, resistant to clogging.Easy Installation: No plumber and tools need, installs in minutes. Fits any standard shower arm. With upgraded package which includes 59inch flexible stainless steel shower hose, angle-adjustable bracket, PTFE tape and washers.The details are as described aboveWhat's In the Box1 x Hand shower1 x 1.5m hose1 x Bracket1 x Raw material belt
9 Settings High Pressure Handheld Shower Head, Easy to
9 Settings High Pressure Handheld Shower Head, Easy to
₦ 71,676.47 ₦ 75,448.92 -5%
loader
915 Generation
Brush Head for Dreame V9 V10 V12 T10 T20 Wireless Vacuum
Detailed Information About The Product:as description and high qualityMade of high-strength and environmental protection materialEasy to installIt is suggested that it should be repd every 1 -2 months.Material: plasticcolour: Grey blackPackage Contents:1 x brush headOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityBrush Head for Dreame V9Brush HeadDreame t10Dreame V9Dreame V9 AccessoriesThe details are as described aboveWhat's In the Box1 x brush head
Brush Head for Dreame V9 V10 V12 T10 T20 Wireless Vacuum
Brush Head for Dreame V9 V10 V12 T10 T20 Wireless Vacuum
₦ 67,474.30 ₦ 71,025.58 -5%
loader
915 Generation
Utting for TWK TM 767 800 TWK Jtc 767 800 s Ice
Detailed Information About The Product:as description and premium qualityEight- , supplied with sealing ringIt is compatible with the machine that has 2L capacitySuitable for TW TM 767 768 800 juicer smoothie blenderHardened Six Mixing and TWK 767 800 s !Item suitable for TWK TM-767 TM-800,JTC 767,800Material:Stainless steelcolour:silverPackage Contents:1 * 8 head2 * mushroom head1 * opening tool1 * fixing plateOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityJuicer Ice sjuicer smoothie blenderfor TW 767for Universal 2L MachineFor TWK TM 767 800 TWK jtc 767 800The details are as described aboveWhat's In the Box1 * 8 head2 * mushroom head1 * opening tool1 * fixing plate
Utting for TWK TM 767 800 TWK Jtc 767 800 s  Ice
Utting for TWK TM 767 800 TWK Jtc 767 800 s Ice
₦ 44,290.49 ₦ 46,621.57 -5%
loader
Generic
Upholstery & Carpet Cleaning Attachment Hand Wand With
DIY A CARPET EXTRACTOR: Convert your regular shop vac into a powerful extractor, a great alternative to buy a professional extractorSTRONG STAINLESS STEEL TUBE: Standard 1-1/2inch vacuum tubing compatible with portable extractors & truck mount and most carpet cleaning system for optimal cleaning supportSEE-THROUGH HEAD: The clear head lets you view the whole cleaning process and effect, see the dirt and impurities being cleanedMULTIPURPOSE HOME AND VEHICLE USE: if you've got a shop vac you need a professional extract head that enhances your suction capabilities and cleans things up quickly and easily. We developed this extractor tool to ensure you clean up with improved accuracy and efficiency in your house, in your car, and everywhere you need a little fine-tuned detailingSUPERIOR QUALITY AND REUSABLE: The vacuum attachment hand wand is made of high-quality materials for long-lasting durability and elasticity, very lightweight and easy to useColour: As ShownMaterial: plastic+steelSize: Steel pipe length: 15cm, Brush head: 15 x 9.3cm(Small)Package Contents:1 x Vacuum Cleaner Brush Head1 x Steel TubeOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Featuresvacuum floor nozzleVacuum Floor NozzleCarpet Cleaner NozzlesVacuum Cleaner Brush HeadVacuum Cleaner Brush NozzleWhat's In the Box1 x Vacuum Cleaner Brush Head1 x Steel Tube
Upholstery & Carpet Cleaning Attachment Hand Wand With
Upholstery & Carpet Cleaning Attachment Hand Wand With
₦ 27,018.48 ₦ 28,440.50 -5%
loader
Generic
High Pressure Shower Head with Pause Mode and Massage Spa,
High Pressure: Our handheld shower head provides impressive pressure and powerful spray no matter how low the water pressure is, let you and your family enjoy natural spa at home.Each shower heads has a flow rate of 1.8 gallons per minute (GPM) and a water consumption of 1.8 gallons per minute (GPM), allows you to enjoy your bathing journey for longer.Pause Mode: It allows you to temporarily shut the water down for easy control of the water temperature you want. Be easy to use and save water, which brings you great convenience.Durable Material: High-quality ABS plastic body polished chrome makes it sturdy, drop resistant and lightweight, not easy to damaged when dropping from height.Easy Installation: We use standard interface that matches every standard shower arm or water pipe. You can easily install it in minutes without any tools.5 Settings Handheld Shower HeadOur handheld shower head creates a pressure-increasing stream to give you powerful water spray even if you typically experience low water pressure, which will allow you and your family to enjoy a natural SPA at home.Our handheld shower head allows you and your family to lessen stress, relieve fatigue, ease tension and relax muscle. Let the massage of high-pressure water relieve the stress of your day.Colour: silverMaterial: ABSPackage Contents:1 * Handheld shower head1 * 59 inch shower hose1 * Angle-adjustable overhead bracket1 * Raw material tapeOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Featuresshower head with hosehigh pressure shower headshowerheaddetachable shower headshower heads high pressureWhat's In the Box1 * Handheld shower head1 * 59 inch shower hose1 * Angle-adjustable overhead bracket1 * Raw material tape
High Pressure Shower Head with Pause Mode and Massage Spa,
High Pressure Shower Head with Pause Mode and Massage Spa,
₦ 71,948.09 ₦ 75,734.83 -5%
loader
Generic
5D Electric Shavers Replacement Heads Blades Heads Bald Gre
Detailed Information About The Product:1.Replacement Head: You can replace or broken heads to give the product a . 5d flex floating heads rotate to the of your , head, neck and , offering closer and cleaner trimming without irritation.2.5D Shaving Blade Replacement: The replacement adopts a design of 5-blade nets to further increase the contact area with your . Increase the contact area, built-in sharp blade, efficient and convenient shaving, reduce back scratches.3.Automatic Grinding Head: During the use of the electric , the net and the blade rub against each other to realize the automatic head grinding function, which makes the electric blade sharper and brings you a comfortable and efficient shaving experience.4.Waterproof Head: The head blade for men allows you to clean after shaving. You can open the head and clean the inside, which can reduce the residual beard residue in the razors head and extend the service life of the head.5.Universal Head Blade: Universal replacement blade heads for all 5 head razors. As long as it is the same as the head replacement interface of an electric , it can be replaced. Colour:greyMaterial:Plastic Metal Package Contents:1 x blade heads Only the above package content, other are not included.Note: Light and different displays may cause the color of the item in the a little different from the real . The measurement allowed error is /- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customers. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please dont be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key FeaturesDurable and good quality Blade HeadsShavers Replacement HeadsBald Head Shavers Heads5D Electric Shavers Heads Head For MenThe details are as described aboveWhat's In the Box1 x Shaver blade heads
5D Electric Shavers Replacement Heads Blades Heads Bald Gre
5D Electric Shavers Replacement Heads Blades Heads Bald Gre
₦ 20,387.68 ₦ 21,460.72 -5%
loader
Generic
Temperature Display Shower Head Handheld No Charging Required Bathroom High Pressure Water Saving 4 Modes Shower Head -4
1. Temperature display(Built in battery, without charging, can be used for 120000 times)2. Four Shower Modes,with Pause Button3. High Pressure4. Water Saving5. High quality thickened ABS materialSpecifications:Type: Hand Shower HeadInstallation type: Universal Quad interfaceInterface standard: G1/2,Diameter=2cmColour: YellowMaterial: ABSSize: 28x9x2cmPackage Contents:1 x Shower HeadOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesShower HeadHandheld Shower HeadBathtub FaucetHand-Held Bath FaucetsHigh Pressure Shower HeadWhat's In the Box1 x Shower Head
loader
915 Generation
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
Detailed Information About The Product:Distribute heat evenly Being able to heat evenly can improve cooking quality and, most importantly, enhance the taste of the food, making it easy to cook.At the right temperature Heat sinks are very useful when cooking heat-sensitive foods. Can be used to simmer sauce, rice, oats, caramel or melted chocolate, keeping cooking at a lower temperature.High-tech design The project can also be used as a gas hob triple stabilizer, no matter how small the pan. Plus, the diffuser comes with a handle so you can easily move it without risking burning yourself. In addition, you can hang it by your fireplace, which is convenient and fast.Energy saving: Shave off a few dollars on your gas and energy bill by switching to induction cooking - our diffuser plate allows you to cook more with less energy and heat for all-around savings.Protect your cookware: If you're tired of having to buy pan after pan due to overexposure to flame, our heat diffuser plate is perfect, as it will provide your cookware with years of additional life.Colour:SilverMaterial:stainless steelSize:20cm in diameterPackage Contents:1 * Thermal boardOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have anyeas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !_xFFFF__xFFFF__x0001_Key FeaturesDurable and good qualityDistribute heat evenly Being able to heat evenly can improve cooking quality and, most importantly, enhance the taste of the food, making it easy to cook.At the right temperature Heat sinks are very useful when cooking heat-sensitive foods. Can be used to simmer sauce, rice, oats, caramel or melted chocolate, keeping cooking at a lower temperature.High-tech design The project can also be used as a gas hob triple stabilizer, no matter how small the pan. Plus, the diffuser comes with a handle so you can easily move it without risking burning yourself. In addition, you can hang it by your fireplace, which is convenient and fast.Energy saving: Shave off a few dollars on your gas and energy bill by switching to induction cooking - our diffuser plate allows you to cook more with less energy and heat for all-around savings.Protect your cookware: If you're tired of having to buy pan after pan due to overexposure to flame, our heat diffuser plate is perfect, as it will provide your cookware with years of additional life.The details are as described aboveWhat's In the Box1 * Thermal board
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
₦ 55,123.46 ₦ 58,024.69 -5%
loader
Generic
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
Universal Brush Carpet Seat Washing ApparatusSeat and carpet washing water absorbent vacuum head universal compatibleIt is used to absorb water after seat and carpet washing.Shows the absorption of water through the transparent phone.100% brand new and high qualitySelected materials, long-term use will not be damaged, fine workmanship.Vacuum Part Type: BrushesType: Vacuum Cleaner PartsFor Universal 38mm Wet/Dry Vacuum Cleaner Water Nozzlesize:The inner diameter 38mmSteel pipe: 21cmMaterial:Plastic + Metalcolour:Silver + TransparentPackage Contents:1 * Steel pipe1 * Big Brush Head(192x190mm)1 * Small Brush Head(150x93mm)Only the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key FeaturesVacuum Floor NozzleCarpet Cleaner HeadVacuum Cleaner Brush HeadVacuum Cleaner PartsUniversal Vacuum NozzleWhat's In the Box1 * Steel pipe1 * Big Brush Head(192x190mm)1 * Small Brush Head(150x93mm)
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
1Set Carpet Cleaner Nozzles Universal 38mm Cleaner Nozzle
₦ 67,202.69 ₦ 70,739.67 -5%
loader
915 Generation
Dryer Cleaning Tool & Vacuum Attachments for Dyson V11 V10
Detailed Information About The Product:Compatible With:The Tool kit for Dyson V7 V8 V10 V11 provides essential tools to clean all areas around your home and your car.Made of environmental protection material.This home tool kit has been designed to remove dirt and dust from mattresses and upholstery with the mattress stair tool, paired with the stubborn dirt brush which removes dirt from hard wearing carpets of your home and car.Please note this part is a non compatible spare part and the manufacturers' names and part numbers have been used for reference purposes on.Colour: as shownMaterial: plasticPackage Contents:1 * Soft brush1 * Hard brush1 * 2-In-1 suction head1 * Flat nozzle tip1 * Hose1 * Mattress suction1 * Cleaning brush1 * Long flat nozzle tipOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualitySuction Head for DysonConnector Hose for DysonCleaner Brush for DysonCleaner Parts for DysonConnector Hose Kit for DysonThe details are as described aboveWhat's In the Box1 * Soft brush1 * Hard brush1 * 2-In-1 suction head1 * Flat nozzle tip1 * Hose1 * Mattress suction1 * Cleaning brush1 * Long flat nozzle tip
Dryer Cleaning Tool & Vacuum Attachments for Dyson V11 V10
Dryer Cleaning Tool & Vacuum Attachments for Dyson V11 V10
₦ 80,560.13 ₦ 84,800.14 -5%
loader
915 Generation
60 Plasma Accessories, Torch Electrode for
Detailed Information About The Product:Nozzles and electrodes are made of high quality copper material.You can rep the broken one during the process and easily complete the process.Nozzles are considered plasma consumables, they are essential for the plasma project.Easy to change: Many nozzles and electrodes are spares, convenient to rep the broken ones during the process, the project runs smoothly.Professional Accessories: Nozzle considered as a plasma consumable, they are essential for the plasma projectMade of high-quality material, durable and practical to use.Category: Plasma Machine BurnerType: Consumables Kit for Plasma MachinesSuitable for AG-60 SG-55 WSD-60 plasma burner accessoriesSpecifications:Colour: silverMaterial: copper + stainless steelSize: protective cap: 2X1CMItem type: plasma & air compressorPackage Contents:10 x insulation ring.10 x protective caps.40 x fine electrode.40 x nozzlesOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any_x0000__x0000__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0014__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0007__x0000__x001B__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x000F__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x0000__x001C__x0000__x001B__x0000__x0001__x0000__x001C__x0000__x001B__x0000__x0001__x0000__x0003__x0000__x0000__x0000_¨_x0000__x0000__x0000__x0002__x0002_W_x0000__x0001__x0000__xFFFF__xFFFF__x0001_Key FeaturesDurable and good qualityplasmaplasmaschneiderstahlwerk plasmaschneiderparkside plasmaschneiderplasma The details are as described aboveWhat's In the Box10 x insulation ring.10 x protective caps.40 x fine electrode.40 x nozzles
60 Plasma  Accessories, Torch Electrode for
60 Plasma Accessories, Torch Electrode for
₦ 152,859.73 ₦ 160,904.98 -5%
loader
Generic
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
Detailed Information About The Product:Distribute heat evenly Being able to heat evenly can improve cooking quality and, most importantly, enhance the taste of the food, making it easy to cook.At the right temperature Heat sinks are very useful when cooking heat-sensitive foods. Can be used to simmer sauce, rice, oats, caramel or melted chocolate, keeping cooking at a lower temperature.High-tech design The project can also be used as a gas hob triple stabilizer, no matter how small the pan. Plus, the diffuser comes with a handle so you can easily move it without risking burning yourself. In addition, you can hang it by your fireplace, which is convenient and fast.Energy saving: Shave off a few dollars on your gas and energy bill by switching to induction cooking - our diffuser plate allows you to cook more with less energy and heat for all-around savings.Protect your cookware: If you're tired of having to buy pan after pan due to overexposure to flame, our heat diffuser plate is perfect, as it will provide your cookware with years of additional life.Colour:SilverMaterial:stainless steelSize:20cm in diameterPackage Contents:1 * Thermal boardOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have anyeas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !_xFFFF__xFFFF__x0001_Key FeaturesDurable and good qualityDistribute heat evenly Being able to heat evenly can improve cooking quality and, most importantly, enhance the taste of the food, making it easy to cook.At the right temperature Heat sinks are very useful when cooking heat-sensitive foods. Can be used to simmer sauce, rice, oats, caramel or melted chocolate, keeping cooking at a lower temperature.High-tech design The project can also be used as a gas hob triple stabilizer, no matter how small the pan. Plus, the diffuser comes with a handle so you can easily move it without risking burning yourself. In addition, you can hang it by your fireplace, which is convenient and fast.Energy saving: Shave off a few dollars on your gas and energy bill by switching to induction cooking - our diffuser plate allows you to cook more with less energy and heat for all-around savings.Protect your cookware: If you're tired of having to buy pan after pan due to overexposure to flame, our heat diffuser plate is perfect, as it will provide your cookware with years of additional life.The details are as described aboveWhat's In the Box1 * Thermal board
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
Cooking Heat Diffuser Plate Electric Cooker Induction Hob
₦ 56,896.99 ₦ 59,891.57 -5%
loader
Generic
Shower Head, High Pressure 5 Settings Showerhead with
5-Setting: Rain Mode, Massage Mode, Mixed Mode, Pulse Mode, Spray Mode. Five shower modes can make you and your family enjoy natural comfortable shower at home.Excellent Construction: Our shower heads are built to the highest quality plastic and the latest fine-spray chrome technology for durability. It has an adjustable angled brass ball joint that you can adjust for any shower angle what you want.Easy Installation: Our shower head use a standard G1/2 interface and you can install it without any tools (we will provide PTFE tape for you).Colour: silverMaterial: ABSPackage Contents:1 * Shower headOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3810. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Featuresshower head with hosehigh pressure shower headshowerheaddetachable shower headshower heads high pressure
Shower Head, High Pressure 5 Settings Showerhead with
Shower Head, High Pressure 5 Settings Showerhead with
₦ 35,534.66 ₦ 37,404.90 -5%
loader
Generic
Double Floor Brush Head Tool for Dyson V7 V8 V10 V11 Vacuum
Detailed Information About The Product:1. It is as description and has premium quality2. as description double roller brushes to improve cleaning efficiency3. Easy to install and remove4. It is a pretty replacement for your old, broken, non-working floor head5. Applicable Model: Fit for Dyson V7 V8 V10 V11 VacuumColour: as shownMaterial: plasticPackage Contents:1 x Vacuum Floor Brush Head(Built-in 2 roller brush)1 x blue tube1 x screwdriverOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.22681. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good quality1. It is as description and has premium quality2. as description double roller brushes to improve cleaning efficiency3. Easy to install and remove4. It is a pretty replacement for your old, broken, non-working floor head5. Applicable Model: Fit for Dyson V7 V8 V10 V11 VacuumThe details are as described aboveWhat's In the Box1 x Vacuum Floor Brush Head(Built-in 2 roller brush)1 x blue tube1 x screwdriver
Double Floor Brush Head Tool for Dyson V7 V8 V10 V11 Vacuum
Double Floor Brush Head Tool for Dyson V7 V8 V10 V11 Vacuum
₦ 153,610.70 ₦ 161,695.47 -5%
loader
Generic
2 Pcs Coffee Milk Tea Dispenser Syrup Pump Black Liquid Dispenser for Torani Syrup Juice Bottle Dispenser Pump
Function: very suitable for individuals and professionals to add your drinks, food and cooking exploration.Exquisite design: The exquisite design has a fixed angle to ensure that every single time use.Quantitative: each press can press 8ml.Great for adding syrup to coffees, tea, sodas, smoothies, cocktails, milkshakes and more.High quality syrup pumps.Model Number: Pumpcolour:GoldMaterial:plasticPackage Contents:2 x Pump headOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesSyrup PumpSauce Pumpfor Torani Syrup PumpLiquid DispenserJuice Bottle Dispenser PumpWhat's In the Box2 x Pump head
loader
915 Generation
Swivel Head Vacuum Cleaner Brush Nozzle Vacuum Cleaner
Detailed Information About The Product:DIY A POWERFUL EXTRACTOR - This versatile tool turns any wet/dry vacuum into an extraction system that removes dirt, mud, and grime and helps you save money over a professional extractor, a good investment while you save for an expensive carpet extractor. Convert your regular shop vac into a powerful extractor, a great alternative to buy a pro extractorTRANSPARENT CLEANING HEAD - The see-through head in 3-1/2inch width allows you and your customers to see the dirt being cleaned off their upholstery and view your dirty recovery work. So you can see how effective and efficient it is at removing stains and dirt in real time. This extractor tool help extract solution out of vehicle and living room upholstery/carpetMULTIPURPOSE HOME AND VEHICLE USE- Our high-quality vacuum wand is safe for furniture, upholstery, carpets, rugs, floor mats, and more for convenient deep cleaning needs. if you've got a shop vac you need a professional extract head that enhances your suction capabilities and cleans things up quickly and easily. We developed this extractor tool to ensure you clean up with improved accuracy and efficiency in your house, in your car, and everywhere you need a little fine-tuned detailingEASY TO CLEAN AND REUSE - Long-lasting durability and resilience, so you can continue to use it for personal or professional use on tons of indoor projects. Very light and easy to use for upholstery cleaning, automatic details and mattress cleaningIMPROVED COMPATIBILITY - The connection inside diameter 1-1/2inch(38mm). Compatible with portable extractor & truckmount and most carpet cleaning systemColour:TransparentMaterial:plasticPackage Contents:2 x Vacuum Cleaner Brush HeadsOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityvacuum floor nozzleVacuum Floor NozzleCarpet Cleaner NozzlesVacuum Cleaner Brush HeadVacuum Cleaner Brush NozzleThe details are as described aboveWhat's In the Box2 x Vacuum Cleaner Brush Heads
Swivel Head Vacuum Cleaner Brush Nozzle Vacuum Cleaner
Swivel Head Vacuum Cleaner Brush Nozzle Vacuum Cleaner
₦ 27,529.77 ₦ 28,978.70 -5%
loader
915 Generation
Temperature Display Shower Head Handheld No Charging
Detailed Information About The Product:1. Temperature display(Built in battery, without charging, can be used for 120000 times)2. Four Shower Modes,with Pause on3. High Pressure4. Water Saving5. High quality thickened ABS materialSpecifications:Type: Hand Shower HeadInstallation type: Universal Quad interfaceInterface standard: G1/2,Diameter=2cmColour: YellowMaterial: ABSSize: 28x9x2cmPackage Contents:1 x Shower HeadOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityShower HeadHandheld Shower HeadHigh Pressure Shower HeadHand-Held Bath FaucetsBathtub FaucetThe details are as described aboveWhat's In the Box1 x Shower Head
Temperature Display Shower Head Handheld No Charging
Temperature Display Shower Head Handheld No Charging
₦ 49,786.86 ₦ 52,407.22 -5%

Featured Products

View All

Top Stores : Brand Directory