3 Pcs-Pointed House Floor Cleaning Scrubbing Brush
Brush is good for scrubbing rugs, floors, walls, upholsterers, mats, etc. It is strong, durable and handy.rehmie is your number one online shopping site in Nigeria. We are an online store where you can purchase all your electronics, as well as books, home appliances, kiddies items, fashion items for men, women, and children; cool gadgets, computers, groceries, automobile parts, and more on the go. What more? You can have them delivered directly to you. Shop online with great ease as you pay with rehmiePay which guarantees you the safest online shopping payment method, allowing you to make stress free payments. Whatever it is you wish to buy, rehmie offers you all and lots more at prices which you can trust. rehmie has payment options for everyone irrespective of taste, class, and preferences. Here, you also have the option to make your payment on delivery for extra convenience. Shopping online in Nigeria is easy and convenient with rehmie. We provide you with a wide range of products you can trust. Take part in the deals of the day and discover the best prices on a wide range of products.Key FeaturesDurableStrongHandyUsed to scrub
Microfiber Glass Cleaning Cloths Lint Free Rags
The following is the detailed introduction about our products: About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.870. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !The cleaning cloths has unique fish scale pattern, it produces an effectively smooth gliding performance to easily tackle all your dusty, dirty, grimy glass and window needs.This cleaning rags with a non-abrasive design that won't scratch surfaces, paints, furniture, stainless steel, safe for all finishes. perfect for electronic equipment, windows, displays, bathrooms, kitchen etc.Our microfiber cloth remains the softest and most effective product to polishing all delicate surface. Quickly absorbs and holds large amounts of water. It stands out for its consistently smooth finish, its soft Press and its professional detailing performance.Colour: Color(The specified color is not accepted)Material:superfine fiberSize:30 x 40cmPackage Contents:1 * cleaning clothOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.Key FeaturesColour: Color(The specified color is not accepted)Material:superfine fiberSize:30 x 40cmPackage Contents:1 * cleaning clothOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.What's In the Box10 x set of 3-pin waterproof connector
Grout Cleaner Brush Tile Joint Cleaning Scrubber Brush With Nylon Bristles Great Use For Shower Red
Description :Cleaner Brush Tile Joint Cleaning Scrubber Brush with Nylon Bristles Set for Shower Floors Kitchen and HouseholdLarge Brush is perfect for grout, floor tile joint, shower, kitchen, toilet bowl, stove tops and cleaning grout, pool tile, flooring, brick and ceramic.Small Brush is great for getting the grout in the corners and where the walls meet the floor clean, it also can works at all kinds of nooks and little holes.The handle is comfortable and you can put a lot of downward on the brush without it slipping in your hand.The bristles are very stiff and fit into the grout line nicely.Clean the grout on your floor, they are everything you hoped that would be and love them.They are well made, very easy to hold, and the bristles are firm and get the grout clean in no time.Also use them around the kitchen sink and places that need a firm brush.Warm Tips:Check the grout for cracks or loose .Some cleaners and sealants can be potent enough to require special precautions.If you don't have protective gear, invest in a set of splash-proof , chemical-resistant waterproof , and a (a paper is insufficient).This job doesn't require special skills, but it does require patience.So load some fresh tunes and podcasts on your MP3 player, invest in a pair of knee pads for working on tile floors, and give the job the time it takes.If your grout is new and has had several days to harden, skip the cleaning step or spot-clean as needed and go straight to the section on sealing the grout.Create plenty of ventilation to carry away cleaner and sealer odors.Some commercial cleaners and bleach mixes can damage fabrics, so don't wear your best blue jeans for this job.Specification :Material:PlasticSize :13*9*2CM:Green, RedApplication,Kitchen, Bathroom and so onPackage Includes :1 x Large Brush1 x Small BrushDetails Pictures : a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Large Brush 1 x Small Brush
D-LUX MICROFIBER BELT MOP
D-LUX MICROFIBER BELT MOPIT CAPTURES GREASE, DIRT, AND DUST WITHOUT STREAKINGIDEAL FOR USE ON ALL TYPE OF WASHABLE HARD FLOORINGCHROME HANDLE FOR EXTRA STRENGTH AND SUPPORTBig Mopping Stick is your solution to all those annoying stains on your tiles. In this present day, nobody really uses rugs in their homes anymore. But what use is it if you have the most expensive tiles in your multi-million naira home, but your tiles are messy and stained. This large sized mopping stick is made with a bundle of soft cotton strings and other very absorbent materials. This cloth like part is perfectly fitted to and attached to a strong long pole (stick). Acting as a multipurpose cleaning tool, the mop is specially used to soak of all kinds of liquids, cleaning floors, other kinds of surfaces and even to mop up dust. This has been the traditional way of mopping up dirty surfaces for decades and has proven to still be one of the most effective ways till date. All you need is water, bucket and some liquid or powdered soap; all this plus your trusted old big mopping stick is what you need to achieve that perfect clean surface.Big Mopping Stick is the perfect size, it is not too big to carry, neither is it too small that it is not efficient. The pole (stick) is very strong to prevent that annoying breakage we witness when mopping with energy. The cotton made clothe is also thick and very absorbent. You can be sure the cotton string do not pull out randomly during use, as they were firmly fitted to last long and get the job done. If you are tired of buying mopping stick that last only days before getting damaged, this is the best choice for you.Key FeaturesDehydration Rate:80% -90%Packaging:With 1 MopheadType: Cloth Cover Type, BELT mopAbsorption: 20-30 secondsPole Material:CHROME HANDLEMop Head Material:cotton thread
Usage:Airplane, Home, Hotel, Kitchen, Car, Sports, OtherColor:blueFunction:High water absorption,Quickly dry,Anti-bacterial,Much more durableMicrofiber refill: cotton thread Size: base size:39x9.5cm; handle length: 130cm
What's In the Box1x D LUX MICROFIBER BELT MOP WITH CHROME HANDLE
Kids Elderly Bathroom Shower Wall Suction Cup Grab Bar Safety Grip
Welcome to my store, we have many kinds of price products, we launch new products every day, please follow my store and pay more attention, for more products, Please click on the seller information to enter our store to buy, we hope give you a pleasant shopping experience. Thank you and have a nice day!Description:Provides assistance and added safetyTwo suction grips provide sturdy supportGrips to any smooth surface in secondsEasy installation and removal with no drilling or damageInstalls in just seconds by placing it on the surface and pushing the safety locking switchBathroom Shower Bath Tub Grip Suction Cup Safety Grab Bar HandrailSpecification:Length: approx 30cm/ 12 inch; 20cm/ 8 inch (You can choose)Material: PlasticColor: SilverPackage Includes:1 x Suction Handle BarBathroom Handle Bar;Bathroom Handle Grip;Suction Handle for Shower;Bath Handle Suction;Bathroom Assist BarKey FeaturesProvides assistance and added safetyTwo suction grips provide sturdy supportGrips to any smooth surface in secondsEasy installation and removal with no drilling or damageInstalls in just seconds by placing it on the surface and pushing the safety locking switchWhat's In the Box1 x Suction Handle Bar
Pink Scourer 4-Pack, Pink
Keep your non-coated cookware, oven racks, and pots and pans grease and grime free with this fantastic 4 pack of hand grip scourers from Elbow Grease which features double-strength materials for heavy-duty cleaning. Hand Grip Scourers are ideal for removing tough stubborn and encrusted stains. The handgrip scourer features a non-scratch tough sponge that is combined with a tough scourer, making this the only scourer you & #39;ll ever need. These double-strength scourers will make washing the dishes easy. Key Highlights: Removes tough and stubborn stains Non-scratch tough sponge Double-strength scourers will make washing the dishes easy Ideal for removing tough, stubborn and encrusted stains from pots, pans, grills and stoves Hand wash and air dry Value for money. Keep your non-coated cookware, oven racks, and pots and pans grease and grime free with this fantastic 4 pack of hand grip scourers from Elbow Grease which features double-strength materials for heavy-duty cleaning. Hand Grip Scourers are ideal for removing tough stubborn and encrusted stains. Key FeaturesRemoves tough and stubborn stains
Non-scratch tough sponge
Double-strength scourers will make washing the dishes easy
Ideal for removing tough, stubborn and encrusted stains from pots, pans, grills and stoves
Hand wash and air dry
Value for money.What's In the Box1 X Elbow Grease Pink Scourer 4-Pack, Pink
6 Pack 5 Inch Mini Tart Pans with Removable Bottom Quiche
Detailed Information About The Product:Deep Groove Edges 5 inch about 12.7 cm) sourdough with removable bottom is made of thickened carbon steel material, which is more durable than other similar . The non-stick, elegant and chic fluted edges are perfect for personalizing pies and helping you bake more delicious desserts.Removable Bottom mini sourdough molds have a bottom for easy handling, they make a perfect sturdy , and the bottom can be easily removed, speeding up cooling without affecting the appearance of the pie, making it easy to make beautiful desserts.Easy to CleanEach sourdough comes with a non-stick surface to bake. These metal quiche pans bake evenly without sticking to the , and it is recommended to brush with oil use for better sterilization. They 't even need cleaning. All pie pans are dishwasher safe.Perfect Size for Small SnacksThis mini tray with removable bottom is perfect for fruit tarts, small quiches, patties, egg tarts, mini lemon tarts, small pecan tarts, cheesecakes and more. It is easy to make a of patties.Wide Application5 inch fluted pie with removable bottom is not only in , also suitable for restaurants, bakeries, buffets, gifts for formal occasions, such as weddings, mother's day, Valentine's Day festivals, birthday parties, entertainment, housewarming celebrations, etc. Colour: blackMaterial: carbon steel Package Contents:6 * Tart Only the above package content, other are not included.Note: Light and different displays may cause the color of the item in the a little different from the real . The measurement allowed error is /- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customers. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please dont be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key FeaturesDurable and good qualityTart Tart MoldQuiche Tartlet MoldMini Tart The details are as described aboveWhat's In the Box6 * Tart Pan
1 Pair Household Women Dishwashing Scrubber Pink
Description:This dishwashingis soft and skin-affinity, which is easy and comfortable to wear.This dishwashinguses long sleeve, which can effectively protect your hands from getting wet.It is constructed of PVC material.There are three sizes for you to choose from.This dishwashingis suitable for daily use.Item Name: LaundryMaterial: PVCFeatures: Lightweight, Durable, Comfortable, WaterproofSize Details:S: 30cm x 13cm/11.81" x 5.12"(Approx.)M: 30.5cm x 13.5cm/12.01" x 5.31"(Approx.)L: 31cm x 14cm/12.2" x 5.51"(Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 Pair of LaundryWhat's In the Box1 Pair of Laundry
30*30 Microfiber Kitchen Car Home Dry Polishing
The following is the detailed introduction about our products: Condition: Brand NewMaterial: MicrofiberSize: 30x30cmcolour: BlueWith great water absorbent abilityUsage: Clean, Wash, and polish your car, your home, or anywhere you used to use traditional towel.Warm Tips: If you are use the towel clean the surface with oil stain, please wet the towel first.Clean your towel immediately after cleaning the staining agent material.Do not use it to clean the rust.Do not wash the towel in the water over 60 cende (about 140 Fahrenheit) or iron the towel.Do not wash the towel with clothes made of other materials.Package includes: 6pcs x cleaning towelsNote: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.32101. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Features 30*30 Microfiber Kitchen Car Home Dry Polishing Cleaning Towels Blue 6PCSUsage: Clean, Wash, and polish your car, your home, or anywhere you used to use traditional towel.Warm Tips: If you are use the towel clean the surface with oil stain, please wet the towel first.Clean your towel immediately after cleaning the staining agent material.Do not use it to clean the rust.Do not wash the towel in the water over 60 cende (about 140 Fahrenheit) or iron the towel.Do not wash the towel with clothes made of other materials.Package includes: 6pcs x cleaning towelsNote: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.What's In the Box6pcs x cleaning towels
2-in-1 RUST AND OIL REMOVAL BRUSH POT EMERY SPONGE
This Multi purpose 2 in 1 rust and oil removal, 13.5cmx9cm, is used to brush pans, kettle, wipe cutting boards and other kitchen utensils. It is a free cutting, easy to used sponge. Perfect for use in the Kitchen, bathroom, garage or outdoors. It has two surface, one side scrubs and the other absorbs and wipe away. It is washable and reusable with a normal size surface area for dish and kitchen use. Good flexibility, easy storage and maintenance. High quality material, Multi purpose cleaning, no damaged to surface, wide applications, lightweight. This Multi purpose 2 in 1 rust and oil removal, 13.5cmx9cm, is used to brush pans, kettle, wipe cutting boards and other kitchen utensils. It is a free cutting, easy to used sponge. Perfect for use in the Kitchen, bathroom, garage or outdoors. It has two surface, one side scrubs and the other absorbs and wipe away. It is washable and reusable with a normal size surface area for dish and kitchen use. Good flexibility, easy storage and maintenance. High quality material, Multi purpose cleaning, no damaged to surface, wide applications, lightweight. Key FeaturesMulti purpose cleaning High quality material Easy storage and maintenance No damage to surface Wide application Two surface sponge Good flexibility Perfect for kitchen, garage, bathroom and outdoor useWhat's In the Box2-in-1 rust and oil removal brush pot Emeryville sponge.
Long Dust Brush Handle Mop Reusable Microfibre Duster Sweeping Brush Non-woven Cleaning 1Pcs Replacement Cloth
Features:-- Are you still worried about cleaning the housework at home, there are often many places in the home that we are difficult to clean, such as door gaps, cabinet tops, door tops, bed bottoms, sofa bottom,chandeliers, windows, etc. These narrow or too high places are difficult to clean with ordinary brooms and rags. Our foldable and retractable dust collector can help you solve these problems. No matter where it is difficult to clean, our dust collector can reach and clean. Dust, which can be extended and retracted according to height, is a good helper for cleaning your house!-- The handle is retractable foldable and the microfiber area can also be bent, making it easy to clean door gaps, door ceilings, chandeliers, windows and difficult places in the home.-- The brush head part is made of material, which has good elasticity and can be bent, no matter where it is cleaned, it will not be difficult to clean because the brush head is too hard-- Microfiber feather technology uses millions of fine fibers to quickly capture dust, dirt, and allergens, so you can clean easily without using harmful chemicals!-- You can clean the clean retractable dust collector directly with water, then wring and reuse-- Space Saving,Hanging hole design for easy storage and quick dryingSpecifications:Name: Household Dust CleanerMaterial: Aluminum alloy rod + microfiber dust coverNon-telescopic length: 55cm/21.65inTelescopic length: 93.5cm/36.81inInstallation Steps1.Put the cloth on the panel2.Tighten the handle and boardPackage Included:1 × Handle Dust Brush or1 x Replacement ClothNote:1.Pleaseallow0.5-1cmdifferencesduetomanualmeasurement.2.Duetothelightandscreendifference,theitem'scolormaybeslightlydifferentfromthepictures. a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 × Handle Dust Brush or 1 x Replacement Cloth
Elastic Wear-resistant Luggage Protective Cover M
Elastic Wear-resistant Luggage Protective Cover1. Material: polyester and spandex2. Function: Breathable and wear-resistant3. Suitable for gender: gender-neutral / male and female4. Side invisible zipper mouth, regardless of left and right handle5. Double layer thickened fabric, high elastic and more wear-resistant6. It is convenient to insert points and not easy to break7. Resin zipper, tight bite, smooth pull8. Four-wire seam, strong and not open9. Digital printing, bright colors, not easy to fade10. Size: S for 18-21 inches, M for 22-24 inches, L for 25-28 inches, XL for 29-32 inches11. Weight: S 240 g, M 310 g, L 370 g, XL 440 gKey FeaturesElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverElastic Wear-resistant Luggage Protective CoverWhat's In the Box1 x package
Magic Reusable Food Grade Silicone Gloves With Brush Good Helper For Cleaning, Household, Dish Washing, Washing The Car
Tensile deformation without fracturebig sizeeasy to get on and offmore comfortable and resilient gloves.Supports machine washable.Silicone washing gloves acceptable temperature range of -104°F/-40°C - 446°F/230°C, can be sterilized in boiled water, microwave or dishwasher(2Min). Hung ring is from top of the middle finger, speedy natural drying, naturally antibacterial.Silicon cleaning gloves made from 100% food grade silicone,LFGB standard. Highly elastic, resilient and does not tear and leak easily. not deformed by Reuse, which is equivalent to the lifespan of 3 pairs of ordinary gloves.Silicone scrubbing dish gloves with 10mm long firmer bristles, can be used for kitchen, washing dishes, fruit & vegetable cleaning, cleaning the bathroom, cleaning the bedroom, removing wardrobe dust, care for pet hair, washing the car, and more.FOOD GRADE SILICONE: Made from 100% food grade silicone, BPA-free, FDA-approved, LFGB standard. non-allergic to latex, This Magic Silicone Gloves can be used in the kitchen to do the dishes, clean fruits & vegetables, for cleaning the bathroom, bed room, removing wardrobe dust, care for pet hair, and washing the car.
Robot Vacuum Strong Suction Ultra-quiet Thin Long-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Robot vacuum has a one-key start function, which can automatically avoid obstacles and prevent falling. And it has the characteristics of low power consumption, ultra-quiet work, and large cleaning area.Low noise robot cleaner has a thin body and stylish appearance. And it integrates sweeping, sucking and mopping, very easy to use. You can use it to clean up large and small dust particles easily.Made of high quality fireproof ABS, the robot vacuum is strong and durable to use.The length of this robot vacuum is 25.8cm, width is 25.8cm, height is 6.8cm.Robot vacuum is helpful for cleaning debris, pet hair, dust and dirt on carpet, hard floor, etc.Item Name: Robot VacuumMaterial: Fireproof ABSProduct Model: OB8: 3.7V (Battery Included)Battery Capacity: 1200mAh Motor Power: 5WDust Box Capacity: 150mlProduct Noise: ≤55dB(A)Product Suction: 1500paWorking Time: 80minCharging Time: 3 hoursColor: Black, White, Gray Features: Ultra-quiet, Thin, LightweightSize Details: Size: 25.8cm x 25.8cm x 6.8cm/10.16" x 10.16" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Robot Vacuum2 x Brushes1 x Cleaning Cloth1 x User Manual1 x USB Charging Cable1 x ScrewdriverKey FeaturesRobot vacuum has a one-key start function, which can automatically avoid obstacles and prevent falling. And it has the characteristics of low power consumption, ultra-quiet work, and large cleaning area.Low noise robot cleaner has a thin body and stylish appearance. And it integrates sweeping, sucking and mopping, very easy to use. You can use it to clean up large and small dust particles easily.Made of high quality fireproof ABS, the robot vacuum is strong and durable to use.The length of this robot vacuum is 25.8cm, width is 25.8cm, height is 6.8cm.Robot vacuum is helpful for cleaning debris, pet hair, dust and dirt on carpet, hard floor, etc.What's In the Box1 x Robot Vacuum2 x Brushes1 x Cleaning Cloth1 x User Manual1 x USB Charging Cable1 x Screwdriver
1Set Accessory Kit For Xiaomi Roborock S7 S7+ T7S T7 Plus T7S Plus
This replacement parts kit is compatible with Xiaomi Roborock S7 S7+ T7S T7 plus T7S plus vacuum cleaner. This kit works as well as the old, perfect fit and easy to install.These accessories are made from environmentally friendly materials for working on carpets and sealed hard floors, including hardwood, tile, marble, laminate and linoleum floors.The replacement part is easy to replace without tools. To keep your household sweeper robot at peak performance, we recommend replacing the kits every 3-6 months. Depending on the frequency of use, it can be replaced for a shorter or longer period of time.color:As shownMaterial:plasticPackage Contents:2 x HEPA filter2 x Black Side Brush2 x mop pads1 x Main BrushOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.3632. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! ! !Key Featuresvacuum cleaner partsFor Xiaomi Roborock S7for T7S PlusRoller Brush for Roborock T7HEPA Filter for T7What's In the Box2 x HEPA filter2 x Black Side Brush2 x mop pads1 x Main Brush
Headboard Dust Cover, Size:180cm
Headboard Dust Cover, Size:180cm1. Soft fabric, odorless and not easy to fade2. It has elasticity and fits the head of the bed better3. The elastic band closes the side, fixed and does not move4. Suitable for all kinds of wooden, leather and fabric headboards5. Suitable for bed head height 50-70cmKey FeaturesSoft fabric, odorless and not easy to fadeIt has elasticity and fits the head of the bed betterThe elastic band closes the side, fixed and does not moveSuitable for all kinds of wooden, leather and fabric headboardsSuitable for bed head height 50-70cmWhat's In the Box1 x package
Dust Clean Glue
Car Dust Dirt Wash Cleaning Gel Slime Magic Mud Auto Vent Computer Keyboard Dirt Dust Remover Car Wash Interior Cleaning ToolsType: Dust Clean Glue, suitable for car, PC Keyboard, Shoes, Handbag, etcfutures: Magic, Super Clean, Car Accessories, Soft, Sticky Adsorption CleanerKey FeaturesDust CleanSoft GumSuper CleanShoesPC KeyboardCar CleanHandbagWhat's In the Box1 in a park
Deep Clean 3 In 1 Liquid Detergent - 3litre
Persil deep clean Gel is the complete laundry detergent for your washing needs. Thanks to its Deep Clean Persil Gel removes even the toughest stains with ease to ensure perfect cleanliness. With a long-lasting and fresh fragrance, your laundry will smell clean long after the wash is complete. For long-preservation of your fabrics, Persil Gel will not harm the fabrics and will not leave behind any residues.Persil Gel is the complete laundry detergent for your washing needs. Thanks to its Deep Clean ,Persil Gel removes even the toughest stains with ease to ensure perfect cleanliness. With a long-lasting and fresh fragrance, your laundry will smell clean long after the wash is complete. For long-preservation of your fabrics, Persil Gel will not harm the fabrics and will not leave behind any residues.Persil Gel is the complete laundry detergent for your washing needs. Thanks to its Deep Clean Persil Gel removes even the toughest stains with ease to ensure perfect cleanliness. With a long-lasting and fresh fragrance, your laundry will smell clean long after the wash is complete. For long-preservation of your fabrics, Persil Gel will not harm the fabrics and will not leave behind any residues.Persil Gel is the complete laundry detergent for your washing needs. Thanks to its Deep Clean Persil Gel removes even the toughest stains with ease to ensure perfect cleanliness. With a long-lasting and fresh fragrance, your laundry will smell clean long after the wash is complete. For long-preservation of your fabrics, Persil Gel will not harm the fabrics and will not leave behind any residues.Key FeaturesWith millions of stain removers.Equivalent to 6kg liquid3liters360 cleanlinessPersilThe green is good on white , blue is multipurpose, purple is good all colour cloth.What's In the Box3pc of Different fregrance
Halloween pumpkin lantern decoration supplies KTV bar night nursery children candy bucket pumpkin bucket wholesale Medium pumpkin bucket with light
What's In the BoxShow in Description
Foreign Charcoal Cook Stove Grill Burner
Do you need a cheaper and highly efficient Economy stove that saves you money, uses few pebbles of charcoal, and you can use it inside your beautiful kitchen, then nenu is the best bet for you. It features beauty, ask exit space , balance top and strength. It's strong, reliable, durable and affordable. Get yours now. Do you need a cheaper and highly efficient Economy stove that saves you money, uses few pebbles of charcoal, and you can use it inside your beautiful kitchen, then nenu is the best bet for you. It features beauty, ask exit space , balance top and strength. It's strong, reliable, durable and affordable. Get yours now.Do you need a cheaper and highly efficient Economy stove that saves you money, uses few pebbles of charcoal, and you can use it inside your beautiful kitchen, then nenu is the best bet for you. It features beauty, ask exit space , balance top and strength. It's strong, reliable, durable and affordable. Get yours now.Do you need a cheaper and highly efficient Economy stove that saves you money, uses few pebbles of charcoal, and you can use it inside your beautiful kitchen, then nenu is the best bet for you. It features beauty, ask exit space , balance top and strength. It's strong, reliable, durable and affordable. Get yours now.Key FeaturesFast cook Blue smooth flame Doesn't blacken your pots Gives food the original native taste Strong and long lastingPortable and trendy Smooth beautiful finishing
Colourful Foam SPonge Scourers
ponge Scourers pads is ideal for washing, scouring and wiping. A must have at home, in the kitchen and in the office.Key FeaturesColourfulIdeal For WashingFor scouringFor WashingFor WipingEasy to use
Polyester-cotton Dust Cover for OfficeJet Pro 8600 Printer Chair Table Cloth Black Outer Silver-grey Lining 20x16x12''
What's In the BoxShow in Description
Multi-function Magic Broom Non-stick Hair Sweeping Artifact Sweeping Hair Wiper Scraper Broom 180° Rotation Magic Broom
Description： 1.180° Rotation To Clean All Corners. Can Be Hung, Detachable Design, Easy To Install And Store. 2.Our Microfiber Mop Cleans And Dusts With A Streak Free Shine.mop Head Fit All Hard To Reach Places 3. Replaceable Washable Mop Pads Are Absorbent And Durable.Best Mop For Wet And Dry Surfaces. 4.Light Weight And Easy To Use. Expands To 103cm. Product Specifications: Material: Stainless Steel : Green Size: Unfolded: 35*103cm, Shrinkage: 35*66.5cm Weight: 0.8kg Package: 1x Broom a a a a a Key Features180° RotationMaterial: Stainless SteelUnfolded Size: 35*103cmShrinkage Size: 35*66.5cmWeight: 0.8kgEasy To UseReplaceable and WashableDetachable DesignEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1x Broom
Multi Purpose Kitchen Towels - 12pcs
Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Designer Table Towels - 12pcs. These Microfibre hand towels are new innovations to dining/kitchen accessories. They Can be used by all and also as good gift or souvenir for all occasions.Key FeaturesSuperior QualityDurable Effective & ReliableFancifulPack of 12
Bathroom Shower Tub Grab Bar Stainless Steel Safety Toilet Support
Welcome to my store, we have many kinds of price products, we launch new products every day, please follow my store and pay more attention, for more products, Please click on the seller information to enter our store to buy, we hope give you a pleasant shopping experience. Thank you and have a nice day!Description:Shower safety grab bar gives both parent and child steady steps in and around the bathtub, and provides more safety to your family.Wall mounted grab bar provides super strong grasping force. You can use it without concern.Designed with curved bar, it is ergonomical for universal use. Easy to install with included accessories.Made from premium stainless steel, which is durable and not easy to rust for long service time.Simple and elegant bathroom handrail with gold plated appearance that will match well with your home decoration.Specification:Material: Stainless SteelSize: 30cm/40cm/50cm/60cm - 11.8in/15.75in/19.69in/23.62inPackage Includes:1 Piece Bathroom Shower Grab BarNote:1. Please allow a slight color difference between the real item and the pictures due to the difference between monitors.2. Please allow a slight measurement error.Hope for your kind understanding and have a nice shopping day!Bathroom Safety Grab Bar;Home Bathroom Safety Grab Bar Handrail Hand Rail;Bath Shower Toilet Handle Tower Bar Stainless;Elderly Child Handles Bathroom Bathtub Handrails;Tub Hand Grip Toilet Support Rail Disability ;Chrome Tub Handgrip Screws Mounted Home CareKey FeaturesShower safety grab bar gives both parent and child steady steps in and around the bathtub, and provides more safety to your family.Wall mounted grab bar provides super strong grasping force. You can use it without concern.Designed with curved bar, it is ergonomical for universal use. Easy to install with included accessories.Made from premium stainless steel, which is durable and not easy to rust for long service time.Simple and elegant bathroom handrail with gold plated appearance that will match well with your home decoration.What's In the Box1 Piece Bathroom Shower Grab Bar
Liquid Laundry Detergent, Cold Water Original , 165Floz
Tide Plus Coldwater HE turbo clean laundry detergent offers the brilliant clean and colour protection even in cold water. Specially formulated for cold water conditions, giving brilliant clean and using 50% less energy when switching loads from warm to cold. It is formulated with HE turbo clean technology for 10X cleaning power and is recommended by leading high efficiency washing machine manufacturers. Unlike many HE compatible laundry detergents that can slow machines down with over-sudsing, this turbo-charged formula quickly collapses suds and targets tough stains.Tide Plus Coldwater HE turbo clean laundry detergent offers the brilliant clean and colour protection even in cold water. Specially formulated for cold water conditions, giving brilliant clean and using 50% less energy when switching loads from warm to cold. It is formulated with HE turbo clean technology for 10X cleaning power and is recommended by leading high efficiency washing machine manufacturers. Unlike many HE compatible laundry detergents that can slow machines down with over-sudsing, this turbo-charged formula quickly collapses suds and targets tough stains.Tide Plus Coldwater HE turbo clean laundry detergent offers the brilliant clean and colour protection even in cold water. Specially formulated for cold water conditions, giving brilliant clean and using 50% less energy when switching loads from warm to cold. It is formulated with HE turbo clean technology for 10X cleaning power and is recommended by leading high efficiency washing machine manufacturers. Unlike many HE compatible laundry detergents that can slow machines down with over-sudsing, this turbo-charged formula quickly collapses suds and targets tough stains.Ultra-concentrated liquid laundry detergentHigh-efficiencyScent: originalUp to 123 loads4.87 L (1.28 gal) jugWhat's In the Box4.48L
Cleaner Extendable Ceiling Feather Duster Fluffy Cleaning Dusting Brush Long Handled Duster
Package Contents: 1x Long Dust Cleaner 1x Replacement Dust Head Technical Specifications: : White Material: Non-woven + ABS Length: 40- 94cm/15.7-37" Extendable Width: 11cm/4.3" Features and Benefits: >> [270° adjustable duster]: The head covers a large area, the handle is freely deformable, can be bent to 270°, and the ABS handle is retractable,It can wipe small cracks that are difficult to reach, and is easy to rotate and wipe clean, for maximum versatility >> [Extendable duster ]:No more chairs or dangerous ladders climb up,long handled feather duster can be further expanded, extending up to 94cm(37in), and easy to rotate and wipe clean,To make sure that you can easily reach the ceiling, blinds, ceiling fans, bookshelves, tall furniture and even chandeliers >> [Easy to Clean]: This dust head is easy to keep clean,The Duster's head is detachable,you can wash it with warm water or low hot water! >> [Super Vacuuming Ability]:This flexible long reach duster can be used by anyone, has strong electrostatic adsorption capacity, and can absorb small dust and hair,No dust, no hair, and half the dust removal time when cleaning,Anywhere, easy to clean, clean, fast and simple >>[Superior Workmanship]: ABS materials and latest production processes,make sure duster can serve you for many years to come,sturdy and durable, light weight Notice: 1. Please allow 1-3cm error due to manual measurement.Pls make sure you do not mind before you bid. 2. The may have different as the difference display,pls understand. a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1xLong Dust Cleaner + 1xReplacement Dust Head
Private model XBOX ONE game handle PC wired handle xboxone wired game handle private model new black
What's In the BoxShow in Description
Automatic Smart Cleaning Robot Dust Sweeper Vacuum Cleaner Auto Machine Cleaner -- Back / White White
Features: - This Vacuum Cleaner Robot is made of high quality ABS material, durable and not-faded. - Equipped with dust garbage room. Big dust box with double filters. - Automatically move and clean the floor. - The walls and obstacles will change direction immediately. - Flexible obstacle avoidance. Efficient clean. - Low noise and high efficiency. - Ultra-thin body, 65mm thick. The main body is thicker than the industry average, it can easily get through the bottom of sofa, bed and low places. Specification: Name: Vacuum Cleaner Robot Model: 2830 Size: 18*18*7CM Material:ABS + Electronic Components Charging time: about 60 minutes consumption time: about 60 minutes Built-in : 18650 capacity: 1800mA Voltage: 3.7V Speed:1500 rpm Product accessories: 1 X Vacuum Cleaner Robot, 1 X Charging line, 2 X Brush, 1 X Instructions Please Notes: 1.Please allow slight dimension difference due to different manual measurement. 2.Due to the different and light effect, the actual of the item might be slightly different from the showed on the pictures. Thank you! a a a a a Key Features: Back / WhiteSize: 18*18*7CMMaterial: ABS + Electronic ComponentsBuilt-in : 18650 consumption time: about 60 minutes capacity: 1800mALow noise and high efficiency and high qualityEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 X Vacuum Cleaner Robot, 1 X Charging line, 2 X Brush, 1 X Instructions
Manual Carpet Sweeper 3 Brush Hard Floor Rug Cleaner Duster Collector & Handle Khaki
Package Included: 1 x Carpet Sweeper 1 x Removable Aluminum pipe （Used in all kinds of carpets, and cement and tile is not used very good） Features: - No electricity requried - 360°rotation Axis - ABS material - Removable Aluminum pipe, the length of Carpet Sweeper is adjustable Specification: Product Name: Carpet Sweeper Model:802191 :Purple/White Material:ABS (Acrylonitrile Butadiene Styrene Copolymers)+Aluminum Size:24cmx21cmx4.26cm/9.45''x8.27''x1.67'' Dustpan Material: Plastic Broomstick Material: Plastic Broom Head Material: Fiber Type: Hand Brush and Dustpan a a a a a Key FeaturesNo electricity requried360°rotation AxisABS materialRemovable Aluminum pipe, the length of Carpet Sweeper is adjustableEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Carpet Sweeper1 x Removable Aluminum pipe
Food Plastic Gloves PE Eco-friendly Fruit Vegetable Gloves Disposable Gloves For Restaurant Kitchen BBQ 50PCS
Features:1. Lightweight and portable, convenient to use.2. Disposal and hygiene, can be use in multi-purpose.3. Anti-oil, use sensitive, disposable HDPE film gloves to keep your hands skin too much alkaline cleaning agent.Description:Dense without holes, the selection of high quality, workmanship and meticulous.Specifications:Color:transparent MateriaNotes:Key Features1. Lightweight and portable, convenient to use.2. Disposal and hygiene, can be use in multi-purpose.3. Anti-oil, use sensitive, disposable HDPE film gloves to keep your hands skin too much alkaline cleaning agent.Color:transparentMaterial: PEWhat's In the Box50/100pcs * Disposable Gloves
2 Piece Pack 6-Sided Donut Baking Pan Carbon Steel Donut
Detailed Information About The Product:Multi-cavity and mini design: Each pan has six cavities for baking, which is a must for your mini cake baking. And it effectively makes foolproof chocolate donuts and bagels.[Strong and fast heat dissipation]It is made of strong and durable carbon steel. The pot can be reused many times. It conducts heat quickly and makes an excellent cake.Seamless: This doughnut tray has an integrated design, no welding gaps and spots, and the rolled-up edge design can protect your hands.Practical and washable: As long as you want to make delicious mini cakes, you can use this baking tray. The non-stick coating is easy to demould and clean up, easy to use, and dishwasher safe.Suitable for various occasions: The doughnut plate is very suitable for making high-quality family dishes, afternoon tea, banquet desserts and other delicacies, suitable for daily cooking, family dinners, friends gatherings, festive celebrations, etc.Colour: blackMaterial: carbon steelSize: 27 x 18 x 2CMPackage Contents:2 x Non-stick donut mouldOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.7332. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityMulti-cavity and mini design: Each pan has six cavities for baking, which is a must for your mini cake baking. And it effectively makes foolproof chocolate donuts and bagels.[Strong and fast heat dissipation]It is made of strong and durable carbon steel. The pot can be reused many times. It conducts heat quickly and makes an excellent cake.Seamless: This doughnut tray has an integrated design, no welding gaps and spots, and the rolled-up edge design can protect your hands.Practical and washable: As long as you want to make delicious mini cakes, you can use this baking tray. The non-stick coating is easy to demould and clean up, easy to use, and dishwasher safe.Suitable for various occasions: The doughnut plate is very suitable for making high-quality family dishes, afternoon tea, banquet desserts and other delicacies, suitable for daily cooking, family dinners, friends gatherings, festive celebrations, etc.The details are as described aboveWhat's In the Box2 x Non-stick donut mould
2PCS Microfiber Replacement Mop Head For Spin Mop 360° Rotating Spin Mop For Vileda And O-Cedar Steam Mops. White
Similar ItemsDescription2PCS microfiber mop replacement head adapts to O-Cedar Vileda 360 degree rotating mopaccessoriesFeature:-100% and high quality, made of high quality materials, durable, and durable, can serve you for a long time.-It has strong water absorption and dust removal capabilities and can remove dust more effectively.-Deep microfiber cleaner removes and absorbs solid dirt and grime.-Lightweight squeegee The squeegee has a absorbent rope that will not scratch the floor surface.- and delicate, will not scratch your floor.-Washable design, easy to install and clean.-Suitable for easy cleaning of all hard floor surfaces, such as laminate, tiles, -linoleum, marble, slate, ceramics, hardwood, etc.-Suitable for Vileda and O-Cedar steam mops.Specification:Material: cotton yarnSize: 40 * 40 cmcolor: WhiteQuantity: 2The package includes:2 x rotating mopNote:1. Due to the difference between manual measurement and measurement method, please allow a deviation of 2-3mm.2. Please note that due to the lighting effects and the brightness / contrast settings of the , the tones of the website photos and actual items may be slightly different.Detail Image#divImageDetail a a a a a Key FeaturesEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box2 x rotating mop
Portable Anti-Static Lint Hair Remover Roller Clothes Sticky Wool Brush
Key FeaturesMade from qualified material it is reliable and durable. The quick and easy way to eliminate fluff lint dust and crumbs.Keeping your suit looking smart your couch looking clean and your fabrics looking fantastic.Ergonomic handle is comfortable and easy to hold.Perfect for wool clothes knitting clothes sofa etc.Descriptions:Magic lint remover cloth dry cleaning brush.Double roller design very convenient to use.
Scrub Mat 2-Pack, Pink
Keep your kitchen, bathroom, and other areas around your home grease, stain and grime free with the Elbow Grease Pink Scrub Mate Sponge which is ideal for use on multiple items including pots, pans, ovens, worktops, appliances, tiles, kitchen and bathroom sinks, showers, toilets and much more. The Scrub Mate can be used both for indoor & outdoor use so you can even use it for cleaning your garden furniture to make sure it & #39;s fresh for the summer. The Scrub Mate can be hand washed and reused whenever you need it. It & #39;s non-scratch so it will not surface on any surface. OFT & HARD SPONGE: The Elbow Grease Scrub Mate sponge features soft/hard features depending on the water temperature. This magic sponge softens when used in warm water and stiffens in cold water. The product comes back to its hard form when completely dry VERSATILE: Use this magic sponge to clean pots, pans, ovens, worktops, appliances, tiles, kitchen and bathroom sinks, showers, toilets and much more. Perfect for both indoor and outdoor use, the Elbow Grease Scrub Mate will get your garden furniture clean and fresh for the summer season. Ideal for use with the Elbow Grease All Purpose Degreaser spray NON-SCRATCH FLEXIBLE DESIGN: The Scrub Mate can be hand-washed, and reused whenever you need it. Thanks to its non-scratch properties it keeps surfaces 100% dirt, stain and grease-free without damaging them ABOUT THE PRODUCT: Measurements - 13.5x9cm. Hand wash, air dry. Not suitable for coated pots and pans Key Highlights: Removes tough and stubborn stains Non-scratch and flexible to use Soft when wet and hard when dry Hand wash and air dry Not suitable for coated pots and pans Value for money Key FeaturesRemoves tough and stubborn stains
Non-scratch and flexible to use
Soft when wet and hard when dry
Hand wash and air dry
Not suitable for coated pots and pans Value for moneyWhat's In the Box1 X Elbow Grease Scrub Mat 2-Pack, Pink
Plain Euro Chem Chamois Leather 44x46cm + Sponge
Perfect Absorption - Our chamois cloth for car provides the best possible liquid absorption. It's Water absorption is five times more than ordinary towels, wipe your wet hair with it and it will soon dry, fast and easy absorption for any liquid.Environmental & Durability - The car drying towel is made of PVA & MIC material, it survives the thousands of drying uses, highly durable. It is easy to wring it out, machine washable- reuse 100's of times.Soft & Protected - These synthetic chamois are very soft and good extensibility, won't scratch and safe to use on all finishes, protect your car and other cleaning objects.Easy to Store - chamois are easy to wring out and store, do not forget to keep the shammy cloth in a tube and always a little bit wet.Versatile - Our chamois towel has hundreds of drying uses, like car cleaning, screen, window, glasses cleaning, furniture caring, kitchen and bathroom to make them sparkle. Throw away those abrasive synthetic petrolium derived towels and treat yourself to a renewable genuine chamois.Key FeaturesEco FriendlySynthetic ClothAbsorbs Large Amounts Of WaterIdeal For Cleaning Or Drying Your Vehicle, glasses, furniture
2 Piece Pack 6-Sided Donut Baking Pan Carbon Steel Donut
Detailed Information About The Product:Multi-cavity and mini design: Each pan has six cavities for baking, which is a must for your mini cake baking. And it effectively makes foolproof chocolate donuts and bagels.[Strong and fast heat dissipation]It is made of strong and durable carbon steel. The pot can be reused many times. It conducts heat quickly and makes an excellent cake.Seamless: This doughnut tray has an integrated design, no welding gaps and spots, and the rolled-up edge design can protect your hands.Practical and washable: As long as you want to make delicious mini cakes, you can use this baking tray. The non-stick coating is easy to demould and clean up, easy to use, and dishwasher safe.Suitable for various occasions: The doughnut plate is very suitable for making high-quality family dishes, afternoon tea, banquet desserts and other delicacies, suitable for daily cooking, family dinners, friends gatherings, festive celebrations, etc.Colour: blackMaterial: carbon steelSize: 27 x 18 x 2CMPackage Contents:2 x Non-stick donut mouldOnly the above package content, other products are not included.Note: Light shooting and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.About UsWe provide the good product with the best price,we support Wholesale/Drop Shipping Order1. For Drop Shipping order, please remark"dropshipping order", we will prioritize it.2. For Wholesale/Drop Shipping orders, if you have any ideas about the price or package,please contact us in advance,we will give you the best service to satisfy your demands.About Shipments1.We will send out the orders ASAP once your payment is completed normally.2.Please write your complete delivery address with correct phone number and zip code, especially please confirm your full name.About After-sale ServiceWe are reliable seller and we have our professional after-sale service for all of our customs. If there is any question about the order,please contact us in advance ,we will always here until you get a happy answer.About Feedback1. Please check the package and item when you get carefully to make sure there is no problem.2. If you have any problem or are not entirely satisfied with your package,please don't be hesitate to contact us first before leaving negative feedback. We will resolve the problem to satisfy you.7332. If there is no problem, please leave us five star positive feedback.Your affirmation is our greatest motivation ! !Key FeaturesDurable and good qualityMulti-cavity and mini design: Each pan has six cavities for baking, which is a must for your mini cake baking. And it effectively makes foolproof chocolate donuts and bagels.[Strong and fast heat dissipation]It is made of strong and durable carbon steel. The pot can be reused many times. It conducts heat quickly and makes an excellent cake.Seamless: This doughnut tray has an integrated design, no welding gaps and spots, and the rolled-up edge design can protect your hands.Practical and washable: As long as you want to make delicious mini cakes, you can use this baking tray. The non-stick coating is easy to demould and clean up, easy to use, and dishwasher safe.Suitable for various occasions: The doughnut plate is very suitable for making high-quality family dishes, afternoon tea, banquet desserts and other delicacies, suitable for daily cooking, family dinners, friends gatherings, festive celebrations, etc.The details are as described aboveWhat's In the Box2 x Non-stick donut mould
Sponge Scourers - Pack Of - 20 Pieces
DescriptionThis green sponge/scouring pas is ideal for all your scrubbing needs in the kitchen and around the home. This sponge is an abrasive material which is mild on the hand, effective for all your scrubbing needs, suitable for dishes, pots and pans among others, friendly to your kitchen utensils, and multi-purpose and long lasting. This green sponge/scouring pas is ideal for all your scrubbing needs in the kitchen and around the home. This sponge is an abrasive material which is mild on the hand, effective for all your scrubbing needs, suitable for dishes, pots and pans among others, friendly to your kitchen utensils, and multi-purpose and long lasting. This green sponge/scouring pas is ideal for all your scrubbing needs in the kitchen and around the home. This sponge is an abrasive material which is mild on the hand, effective for all your scrubbing needs, suitable for dishes, pots and pans among others, friendly to your kitchen utensils, and multi-purpose and long lasting. This green sponge/scouring pas is ideal for all your scrubbing needs in the kitchen and around the home. This sponge is an abrasive material which is mild on the hand, effective for all your scrubbing needs, suitable for dishes, pots and pans among others, friendly to your kitchen utensils, and multi-purpose and long lasting. Magic Sponge Tile Brush with handle kitchen, magic Decontamination brush does not hurt the pot strong cleaning brush.This cleaning brush can be used in restaurants,TV shopping, Department stores, Super markets.Usage: Household cleaningWhat's In the Box20 pieces of sponge Scourers
Steel Wool Filled Soap Pads X 4
The Steel Wool soap pads is filled with soap, it is easy to use and can be used on pots, frying pans, walls, tiles, Kitchen sinks, Bath room walls, Toilet Sinks etc. Can be used to give you the sparkling looking... the steel wool is filled with soap so you do not need any liquid soap, you can use severally, with the soap all you need to do is after use dry up under the sun. you can use Again and Again.Key Features- Soap Filled- Easy to use- 6 pcs in a Pack- Very Soapy
Grout Brush, Green/Grey/Yellow
This joint cleaning brush with recycled plastic content is equipped with both soft plastic bristles and hard bristles for stubborn dirt. As a result, this brush is particularly suitable for cleaning and cleaning tile joints or difficult to reach places. Its handle is ergonomically shaped, with non-slip soft-grip and has a practical hanging loop. Key FeaturesThorough cleaning of tile joints and other hard to reach areasWith hard and soft plastic bristles: 1 side with hard bristles for stubborn dirt, 1 side with soft bristlesErgonomically shaped handle with non-slip soft-gripMaterial: PlasticValue for moneyWhat's In the Box1 x Grout Brush, Green/Grey/Yellow
Travel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust Covers 25-28 Inch
Travel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust Covers1. This luggage cover is made of durable 300 grams material.2. 15% spandex and 85% polyester. 3. rior sublimation quality and digital print makes the pattern more vivid and the color brighter.4. Thickness cover can protect your luggage against scratch, dust.5. Unique design makes your suitcase instantly recognizable.6. Weight: 160g-350g7. Note: Only include dust-proof cover, not include suitcase.Key FeaturesTravel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust CoversTravel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust CoversTravel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust CoversTravel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust CoversTravel Abrasion-resistant Elastic Luggage Protective Cover Suitcase Dust CoversWhat's In the Box1 x package
Touchless Auto IR Induction Temperature Gauge And
Features:The volume can be adjusted and the position of disinfectant dropping out can be adjusted.Temperature Gauge And Non-washing Disinfection Integrated, considerate tracking and protection.Avoid cross infection. Point your palm or forehead at the temperature probe and within the detection range without touching the skin.Voice broadcast, accurate recognition, rapid identification of fever crowd.Large digital screen, clearer and paste diaplay. Adjustable bracket, suitable for both adult and children. Specifications:Material: ABS+PCMax. Power: 3WMeasurement Way: Infrared InductionMeasurement Distance: 1-5cmMeasurement Range: 32-42.9 deg;C， 89.6 deg;F-109.2 deg;FAllowable Error: +-0.2 deg;CMeasurement Time: 2SHigh Temp. Alarm: gt;37.5 deg;CLiquid Tank Capacity: 300mlLiquid Type: Wash-free/commom Liquid SoapLiquid Output Way: Infrared InductionIndicator Light Color: green（32-37.5 deg;C）, yellow（37.6-38.1 deg;C）, red（38.2-42.9 deg;C）Package Weight: 1310g/70.9oz（Temperature Gauge）530g/18.7oz（Bracket）Package Size: 345*245*120mm/13.6*9.6*4.7in（Temperature Gauge）570*70*70mm/22.4*2.8*2.8in（Bracket）We confidently assure you'll be satisfied with what you get.However, If there's a chance that you are not satisfied with our goods or something else, please let us know before leaving us a Negative feedback. We will try our best for 100% customer satisfaction. Your 5-Star Positive Feedback is much appreciated to us, and your satisfaction is our greatest motivation to move forward.Welcome to Shop Here! Want more Items? Please come visit our SHOP.*Shipping and Packaging All it will be double checked and well packed before sending.It will be dispatched within 5 business days after buyers pay for the order. It usually takes about 14 to 18 working days for delivering the package to the destination(for remote areas,it may take a little longer).Your satisfaction is our first priority.*If you receive the order and it is in good condition,we would be grateful if you would leave us 5 star Positive Feedback for the transaction.Key FeaturesThe volume can be adjusted and the position of disinfectant dropping out can be adjusted.Temperature Gauge And Non-washing Disinfection Integrated, considerate tracking and protection.Avoid cross infection. Point your palm or forehead at the temperature probe and within the detection range without touching the skin.Voice broadcast, accurate recognition, rapid identification of fever crowd.Large digital screen, clearer and paste diaplay.
Telescopic Home Window Glass Scrubber Bathtub Cleaner Kitchen Brush With 3 Pads
Package included: 1 x Telescopic rod 1 x Brush head 1 x Sponge Brush head 2 x Replacement sponge Specification: Product name: Scrubber Bathtub Cleaner and Kitchen Brush Material: Stainless steel + Sponge + Weight: 300g Length: 44-96cm / 17.3-37.7inch(adjustable) Size of sponge: 14*10*2cm / 5.5*3.9*0.8inch : Green + Blue Scenes to be used: Kitchen, bathroom Feature: Adjustable in length Adjustable in angel Multi-brush head Rough surface available Quick installation Description: Made from high quality Stainless steel + Sponge + material, which is not durable but also stable. It is easy and convenient to install and replace the brush head, saving your time and energy. Built under greatly strict quality control standards, resulting in its stable and excellent performance. hard bristles are easy for cleaning and suitable for a wide range of surfaces. Adjustable in length, you can choose a suitable length according to your cleaning area. Equipped with different brush head, suitable for cleaning different scenes. a a a a a Key FeaturesScrubber Bathtub Cleaner and Kitchen BrushMaterial: Stainless steel + Sponge + Weight: 300gLength: 44-96cm / 17.3-37.7inch(adjustable)Size of sponge: 14*10*2cm / 5.5*3.9*0.8inch: Green + BlueScenes to be used: Kitchen, bathroomEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x Telescopic rod 1 x Brush head 1 x Sponge Brush head 2 x Replacement sponge
TB Portable Anti-Static Lint Hair Remover Roller Clothes Sticky Wool Brush
Features:Made from qualified material, it is reliable and durable. The quick and easy way to eliminate fluff, lint, dust and crumbs.Keeping your suit looking smart, your couch looking clean and your fabrics looking fantastic.Ergonomic handle is comfortable and easy to hold.Perfect for wool clothes, knitting clothes, sofa, etc.Descriptions:Magic lint remover cloth dry cleaning brush.Double roller design, very convenient to use.Quickly removes lint, hair and fluff from clothes and upholstery in an instant.Compact and portable, suitable for home, travel, etc.Specifications:Material: plasticColor: Color Size: L: 25*5.5cmS: 22*5.5cmPackage included: 1 x Clothes Sticky Wool BrushNotes:1. Please allow 1-3cm measure error.2. The color of the actual items may slightly vary from the above images due to different computer screen, thanks for your understanding.Product Safety Disclaimer:We do not accept any responsibility or liability for MISUSE of this or any other our products. All our products are extensively tested to comply with rigorous and strict standards. For certain products (e.g. toys, knivess, etc.), we recommend proper supervision as we cannot be held liable for MISUSE or accidents.Welcome to the home of TOBEBETTER, where we mainly focus on selling the most TRUSTWORHTING products in the catogory of everything on the market. Feel free to choose whatever you like from our first-rate products and we promise that we will only be offering you the best products with the most reasonable price. If you find what you have been looking for, still don't forget to click in our shop to see more, we might be suprising you with more deals and offers. After your purchase, don't forget to leave your sincere comments and 17796 stars ratings as the recognization of our hard work! We take your feedbacks very seriously, in order to improve our products, if you have any questions, doubts or suggestions about our products or the store, please feel free to leave a comment and we will get back to you as soon as possible. Don't forget to put our shop into your bookmarks, we will be launching new products everyday! Thank you very much and have a lovely day!Key FeaturesMade from qualified material, it is reliable and durable.The quick and easy way to eliminate fluff, lint, dust and crumbs.Keeping your suit looking smart, your couch looking clean and your fabrics looking fantastic.Ergonomic handle is comfortable and easy to hold.Perfect for wool clothes, knitting clothes, sofa, etc.
Robot Vacuum Strong Suction Ultra-quiet Thin Long-Grey
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Description:Robot vacuum has a one-key start function, which can automatically avoid obstacles and prevent falling. And it has the characteristics of low power consumption, ultra-quiet work, and large cleaning area.Low noise robot cleaner has a thin body and stylish appearance. And it integrates sweeping, sucking and mopping, very easy to use. You can use it to clean up large and small dust particles easily.Made of high quality fireproof ABS, the robot vacuum is strong and durable to use.The length of this robot vacuum is 25.8cm, width is 25.8cm, height is 6.8cm.Robot vacuum is helpful for cleaning debris, pet hair, dust and dirt on carpet, hard floor, etc.Item Name: Robot VacuumMaterial: Fireproof ABSProduct Model: OB8: 3.7V (Battery Included)Battery Capacity: 1200mAh Motor Power: 5WDust Box Capacity: 150mlProduct Noise: ≤55dB(A)Product Suction: 1500paWorking Time: 80minCharging Time: 3 hoursColor: Black, White, Gray Features: Ultra-quiet, Thin, LightweightSize Details: Size: 25.8cm x 25.8cm x 6.8cm/10.16" x 10.16" x 2.68" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Robot Vacuum2 x Brushes1 x Cleaning Cloth1 x User Manual1 x USB Charging Cable1 x ScrewdriverKey FeaturesRobot vacuum has a one-key start function, which can automatically avoid obstacles and prevent falling. And it has the characteristics of low power consumption, ultra-quiet work, and large cleaning area.Low noise robot cleaner has a thin body and stylish appearance. And it integrates sweeping, sucking and mopping, very easy to use. You can use it to clean up large and small dust particles easily.Made of high quality fireproof ABS, the robot vacuum is strong and durable to use.The length of this robot vacuum is 25.8cm, width is 25.8cm, height is 6.8cm.Robot vacuum is helpful for cleaning debris, pet hair, dust and dirt on carpet, hard floor, etc.What's In the Box1 x Robot Vacuum2 x Brushes1 x Cleaning Cloth1 x User Manual1 x USB Charging Cable1 x Screwdriver
Nylon Material Toilet Cleaning Brush Closestool Bathroom Brushes
Description: Weight: 80g : white & blue Size: 45*65*370mm Material: Polypropylene + Nylon Feature: The handle is made form material which is durability that you can easy to use and save time and effort. The material of brush head is more durable than common toilet brushes. It is easier to clean closestool. The brush head can be cleaned the groove and corner of closestool. Can help you more effectively to achieve the best cleaning effect. Package Included: 1 X?Toilet Brush Notice: 1. Due to the difference between different monitors, the picture may not reflect the actual of the item. Please consider this before the purchase. 2. Please allow 1-2cm differs due to manual measurement ! a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 X Toilet Brush
Capsule Desktop Vacuum Cleaner Mini Electric Wireless-Black
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions. Specifications: Supercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise. Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue. Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving. It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass. This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc. Item Name: Desktop Vacuum Cleaner Material: Plastic Power Supply: Built-in 900mAh Battery (Included) Features: Multi-use, Mini, Desktop Cleaning, Capsule Shaped Size: 11cm x 6cm x 6cm/4.33" x 2.36" x 2.36" (Approx.) Notes: Due to the light and screen setting difference, the items color may be slightly different from the pictures. Please allow slight dimension difference due to different manual measurement. Package Includes: 1 x Desktop Vacuum Cleaner 1 x USB CableKey FeaturesSupercharged airflow with 1000Pa strong suction power helps you deeply clean various kinds of the blind corner with low noise.Its removable transparent dust bin is separated from the wind blades, which is safe and harmless and easy to remove without waste residue.Mini size and lightweight design make it easy to clean the desktop by holding it with a hand, portable and space-saving.It can deeply clean pen dust, paper scraps, fruit scraps, hair, dust mites, etc. in one pass.This practical and multi-use vacuum cleaner is suitable for desks, drawers, school bags, bookshelves, keyboards, car interiors, etc.What's In the Box1 x Desktop Vacuum Cleaner1 x USB Cable
Oxi Action Odour Blaster Fabric Stain Remover - 750g X6
Our powerful Oxi action formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try our Oxi multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Key FeaturesFirst-time stain removal, even in a cold wash 30°cIxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester
Non-Fluoride Toothpaste X 2PCS
Euthymol was launched in 1898 and is an antiseptic, fluoride-free toothpaste characterized by its bright pink colour. Since it is antiseptic, Euthymol can help with the prevention of mouth ulcers, keep your teeth and gums clean and healthy. No other toothpaste has the unique strong taste of Euthymol. Euthymol is a brand of antiseptic, fluoride-free toothpaste distributed by Johnson & Johnson that is characterised by its bright pink colour and medicinal taste. It is also notable for its packaging, which is old fashioned, having merely a pattern and the product name. The supply of Euthymol toothpaste was temporarily interrupted in mid-2013 while the product was reformulated due to changes in the European Cosmetics Regulation. The new formulation of Euthymol was released to supply chains in January 2014 and was available in stores in February 2014. The name Euthymol is simply a contraction of eucalyptus and thymol, which were the active ingredients of the original formulation. This was marketed by Parke, Davis and Company as far back as 1896,[3] and as well as toothpaste it was sold as a variety of antiseptic powders and creams, which contained thymol, oil of wintergreen, menthol, eucalyptus oil, boric acid and indigo though modern formulations only contain the first three of those ingredients (amongst other things).Key FeaturesFluoride-free toothpasteIt is antisepticEuthymol can help with the prevention of mouth ulcersKeeps your teeth and gums clean and healthyUnique strong taste
Switch Pro Transparent Handle Ns Oled Wireless Bluetooth
#N/AWe confidently assure you'll be satisfied with what you get.However, If there's a chance that you are not satisfied with our goods or something else, please let us know before leaving us a Negative feedback. We will try our best for 100% customer satisfaction. Your 5-Star Positive Feedback is much appreciated to us, and your satisfaction is our greatest motivation to move forward.Welcome to Shop Here! Want more Items? Please come visit our SHOP.*Shipping and Packaging All it will be double checked and well packed before sending.It will be dispatched within 5 business days after buyers pay for the order. It usually takes about 14 to 18 working days for delivering the package to the destination(for remote areas,it may take a little longer).Your satisfaction is our first priority.*If you receive the order and it is in good condition,we would be grateful if you would leave us 5 star Positive Feedback for the transaction.
Paint Brush, Polish Brush, Wooden Brush, Chip Art Brush
Brushes are implements with handles and block of bristles, hair used especially for cleaning, applying a liquid or powder to a surface. Great utility brushes for use with most paints, Stains, varnish,acrylic and gessoSmooth sanded wood handles, there will be no cracks and inanition,Good elasticity,wear resistance, not easy to bendMade of Blended Silk Bristles and with Red Wood HandlesBrushes are implements with handles and block of bristles, hair used especially for cleaning, applying a liquid or powder to a surface. Great utility brushes for use with most paints, Stains, varnish,acrylic and gessoSmooth sanded wood handles, there will be no cracks and inanition,Good elasticity,wear resistance, not easy to bendMade of Blended Silk Bristles and with Red Wood HandlesBrushes are implements with handles and block of bristles, hair used especially for cleaning, applying a liquid or powder to a surface. Great utility brushes for use with most paints, Stains, varnish,acrylic and gessoSmooth sanded wood handles, there will be no cracks and inanition,Good elasticity,wear resistance, not easy to bendMade of Blended Silk Bristles and with Red Wood HandlesKey FeaturesStongLong-lasting Built according to standardHighly effectiveDoes not wear or break easilyWhat's In the Box1 Brush
Automatic Smart Robot Vacuum Cleaner Home-White
I am an Chinese seller,providing customers with high-quality and low-cost products. The types of products we sell include Home & Kitchen,Health & Beauty,Fashion Clothing,Electronics,Watches & Jewelry,and so on. We keep up with the most popular fashion trends. If you like our products, please follow us and become our followers and fans. Sincerely at your service .Please feel free to contact us if you have any questions.Specifications:The robotic cleaner effectively picks up dirt, pet hair and dust from wooden floors, marble floors and nylon flooring.Capable of identify dangerous place such as desk, and turn direction automatically.Efficiently picking up hair, dust and dirt in all those annoying nooks and crannies under furniture.The cleaner robot runs automatically around home to adsorb the dust and dirt with the microfiber tissue.The microfiber tissue could be removed to clean.Easy operation, can not affected by blockage.Perfect for someone who doest like to sweep the house.Type: Cleaner RobotMaterial: ABSPower: 2.4WVoltage: 3VOccasions: Home, Office, Stores, etcFeatures: Automatic, Rechargeable, Robot Cleaner, Suction Sweeper, Home Cleaning ToolSize: 22.8cm x 22.8cm x 7cm/8.98" x 8.98 x 2.76" (Approx.) Notes:Due to the light and screen setting difference, the items color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement. Package Includes:1 x Auto Cleaner Robot1 x USB CabelKey FeaturesThe robotic cleaner effectively picks up dirt, pet hair and dust from wooden floors, marble floors and nylon flooring.Capable of identify dangerous place such as desk, and turn direction automatically.Efficiently picking up hair, dust and dirt in all those annoying nooks and crannies under furniture.The cleaner robot runs automatically around home to adsorb the dust and dirt with the microfiber tissue.The microfiber tissue could be removed to clean.Easy operation, can not affected by blockage.Perfect for someone who doest like to sweep the house.What's In the Box1 x Auto Cleaner Robot1 x USB Cabel
60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag
60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag1. Product name: Widening three-dimensional dust cover2. Material: Non-woven3. Workmanship, comfort and durability 4. Storage scene: bedroom storage5. Features: Moisture, dust, wrinkle, anti-mite6. Package include: 1 Piece clothing dust coverKey Features60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case Bag60x120cm Three-dimensional Waterproof Dustproof Clothes Cover Suit Dress Coat Garment Case BagWhat's In the Box1 x package
H873 Window Slot Cleaning Brush Seam Door Slot Window Slot
window groove cleaning brush is composed of an premium ABS anti handle and a scouring sponge, can removable and washable, will not dirty your hands, allowing you to clean effortlessly. Moreover, the scouring pad is easy to foam and has strong decontamination .2-in-1 dual-function window cleaning brush, with a dust-scraping shovel, which can be used together.Deep deep into the crevices, corners, blind corners of windows, etc. to quickly decontaminate and remove dust.Window grooves, sinks, cooktops, range hoods, cabinet edges, door seams, cabinet corners can all be used.Removable to replace a new brush head, to use!color:MulticolorMaterial:spongesize:22.35 x 19.81 x 4.70 cmPackage Contents:2 x window brush3 x Gutter Cleaning BrushOnly the above package content, other products are not included.Note: Light reflection and different displays may cause the color of the item in the picture a little different from the real thing. The measurement allowed error is +/- 1-3cm.
High Quality Nano Sponge Magic Eraser Cleaning Cotton Nano Emery Magic SpongeHome Supplies Descaling Small Cleaning Sponge
This magic sponge removes stain or dirt with water. This is a strong multi-functional cleaner. This sponge can be cut into any size for a suitable shape. Size:9.8cm*7cm*1.2cm For different production batches,it maybe about 2 mm errors, It's the normal rangeMade of eco materials comprised of ultrafine fibers and particles, the content of this -edge product is as fine as 1/10 000 of hair. No retail box,items will be packaged safely in Bubble Bags. a a a a a Key Features:As the picture Durable and practicalTop Sales ItemBig DiscountBest MaterialFast DeliveryAfter testing & Good ServiceBig DemandEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 x cleaning sponge
Plastic Leaf Scraper Kitchen Cleaning Tool Pot Bowl Pan Scraper
Description: Thisisascraperforkitchenuse. Itcanbeusedtoshavetheresidualoilfromthefryingpan,shavethestickyricefromthethericecooker,etc. Thelovelyleafshapemadeitdifferentfromtraditionalscrapers. Thepracticalandeasytousescraperwouldbegoodhelperforhousewives. Feature: Type:Scraper Shape: Green leaf Material:PPplastic Size:13.5*7.5cm Package:3xLeafscrapers Note: Productsandimagesmayexistchromaticaberration,pleaseunderstanding! Comparethedetailsizeswithyours,pleaseallow1-2cmdiffersduetomanualmeasurement! a a a a a Key FeaturesReasonable priceDurable and practicalTop Sales ItemEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box3 x Leaf scrapers
Antistatic Straight Handle Dust Cleaning Brush Groove Cleaner For PC Keyboard
Specification: 1. Item: Cleaning Brush 2. Length: 18cm 3. : Black Features: 1. With a long handle, serving as a good cleaning helper for you, Practical and easy to use. 2. Helps to clean the dirt from grooves, nooks and crannies or small places. Package Included: 1 X Antistatic Straight Handle Dust Cleaning Brush Groove Dirt Ash Cleaner for PC Laptop Keyboard a a a a a Key FeaturesLength: 18cmDurable and practicalTop Sales ItemBig DiscountBest MaterialFast DeliveryAfter testing & Good ServiceBig DemandEasy to useExquisite WorkmanshipWell MadeBest Choice and best discountsCustomer Care is Our Top PriorityOffer is Subject to AvailabilityBig SaleWhat's In the Box1 X Antistatic Straight Handle Dust Cleaning Brush Groove Dirt Ash Cleaner for PC Laptop Keyboard
Laundry Bar Soap (Canoe) - 130g X 6
Sunlight 2in1 with spring Handwash Washing Powder is ready to get to work! Made with the best that Sunlight offers, it's sure to clean your clothes thoroughly and make them smell sensational too. It's a luxurious spring fragrance, designed by the world's best perfumers to give you that exquisite spring scent while washing. Its rich spring scent lasts long after your clothes are dry, leaving them smelling just how you love, without any extra effort.How to Use: Sprinkle a handful of Sunlight 2in1 Spring Sensations Handwash Washing Powder into a bucket of clean water. Stir quickly with your hand as the powder dissolves to make foam. Soak for one hour. Wash as normal and rinse well. Don't forget to wash, dry and apply cream to your hands afterwards.How to Use: Sprinkle a handful of Sunlight 2in1 Spring Sensations Handwash Washing Powder into a bucket of clean water. Stir quickly with your hand as the powder dissolves to make foam. Soak for one hour. Wash as normal and rinse well. Don't forget to wash, dry and apply cream to your handsKey FeaturesMild to the skinGood for all fabricsMakes colours look brighterWhite remains whiteReliable Product Nationwide DeliveryWhat's In the BoxCanoe Laundry Bar Soap X 6
Fruit Cleaning Brush Hard Silicone Scrubbers Yellow
Description:The cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.This vegetable cleaning brush adopts hard silicone bristles, which can reach every corner and clean thoroughly.It is constructed of silicone material.The length of this vegetable cleaning brush is 10cm and width is 10cm.This vegetable cleaning brush is suitable for potatoes, sweet potatoes, carrots, corn and more.Item Name: Cleaning BrushMaterial: SiliconeColor: Yellow, Green, White, Purple, BlueFeatures: Multifunctional, Effective, BendableSize Details:10cm x 10cm/3.94" x 3.94" (Approx.)Notes:Due to the light and screen setting difference, the item's color may be slightly different from the pictures.Please allow slight dimension difference due to different manual measurement.Package Includes:1 x Cleaning BrushKey FeaturesThe cleaning brush is designed with finger clip, which fits perfectly and comfortably in the palm of your hand and it will not slip off.Designed with finger clip, this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.The cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off because it is designed with finger clip.The cleaning brush is designed with finger clip, so it fits perfectly and comfortably in the palm of your hand and it will not slip off.The finger clip design of this cleaning brush fits perfectly and comfortably in the palm of your hand and it will not slip off.
Oxi Colour Safe Fabric Stain Remover Powder 1kg X6
Our powerful Oxi action formula provides amazing first-time stain removal, even in a cold wash (30°c). Want our best? Try our Oxi multi action power powder For superior colour maintenance, stain removal and odour elimination. Benefits:First-time stain removal, even in a cold wash 30°cOxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester How to Use:Mix 10g of powder with equal amount of waterApply the mix on the stain and rub as neededLeave the paste on the stain for five minutesmaximum Add another scoop in the wash with your regular detergent Free from chlorine bleachAmazing stain fightersSodium percarbonate- releases active oxygen to lifts out stains and odours safely Tetraacetylethylenediamine (TAED) - boost stain removal even at low temperatureEnzymes - break down food, starch and outdoor stains.Key FeaturesFirst-time stain removal, even in a cold wash 30°cIxy action formula lifts stains from deep with the fibreChlorine-Free formula to keep your colours safeCan be used on everyday coloured fabrics, such as cotton and polyester
